KEGG   Thermoanaerobacter brockii: Thebr_1896Help
Entry
Thebr_1896        CDS       T01409                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tbo  Thermoanaerobacter brockii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M18 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADV80425
JGI: Thebr_1896
UniProt: E8UWP8
Position
complement(1893868..1894851)
Genome map
AA seq 327 aa AA seqDB search
MSVNVELIKKLTQAFGPSGSEEKVFEIIREEVKGFCDEITHDAMGNMICVKKGKGKKIMV
AAHADEIGIMVTHIEEEGFLRFTTIGGVYVEHLVGRRVVFKNGTVGVIGVEHLEDKKDFK
LEKLYIDIGAKDKKEAEELVRIGDSGAFVGEFVEAGDRLVSKAFDDRIGCYVAIEALKNV
KTENELYFVFTVQEEVGLRGATTAAYSINPDFAIAVDVTATGDTPKAKKMAVALGKGAAI
KVMDRSIIVSPSVRDMMIEVAKENNIPYQLEILEFGGTDAGAIHLSRGGVPSGVISIPTR
YVHSVSEMVDKNDVEASINLLIKILEK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaatgtggaacttataaaaaagctaacacaggcttttggaccttcgggaagt
gaggagaaggtttttgagattataagagaggaagtcaaaggcttttgcgatgaaattact
catgatgcgatgggaaacatgatatgtgtgaaaaagggaaaagggaaaaagataatggtg
gctgctcatgctgatgaaataggcattatggttacgcatattgaagaggaaggcttcttg
aggtttacaacgataggtggcgtttatgtagagcatctggtgggaagaagagttgtgttt
aaaaatggtacagtaggagtgattggagtagaacatttggaagataaaaaggattttaaa
ctagaaaagctttatatagacataggagcaaaggataaaaaagaagctgaagagcttgtc
agaataggagatagtggggcttttgtaggggagtttgtagaagctggagataggttagtc
tccaaggcttttgacgacaggataggatgctatgtggcgattgaagcgctaaaaaacgtg
aagacagaaaatgagctgtattttgtcttcacagtgcaggaagaagtaggtttgagagga
gctactacagccgcttacagtattaatcctgattttgctattgctgttgatgttacagca
acgggagatactcctaaagcgaagaaaatggcggtggctctcggtaaaggtgcagcaata
aaggtaatggacagatcaataattgtgagcccttctgtgagagatatgatgattgaagtg
gcgaaagagaacaatattccgtatcaattagaaatactggaatttggcggtactgatgca
ggagcgattcacctttcaagagggggagtaccctctggagtgatttctattcccacaagg
tatgtccacagcgtttcagaaatggtggataaaaatgatgtggaggcaagtattaacctc
ctgataaaaatactggaaaaataa

DBGET integrated database retrieval system