KEGG   Thermoanaerobacter brockii: Thebr_1896Help
Entry
Thebr_1896        CDS       T01409                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thebr_1896
Enzymes [BR:tbo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Thebr_1896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1893868..1894851)
Genome map
AA seq 327 aa AA seqDB search
MSVNVELIKKLTQAFGPSGSEEKVFEIIREEVKGFCDEITHDAMGNMICVKKGKGKKIMV
AAHADEIGIMVTHIEEEGFLRFTTIGGVYVEHLVGRRVVFKNGTVGVIGVEHLEDKKDFK
LEKLYIDIGAKDKKEAEELVRIGDSGAFVGEFVEAGDRLVSKAFDDRIGCYVAIEALKNV
KTENELYFVFTVQEEVGLRGATTAAYSINPDFAIAVDVTATGDTPKAKKMAVALGKGAAI
KVMDRSIIVSPSVRDMMIEVAKENNIPYQLEILEFGGTDAGAIHLSRGGVPSGVISIPTR
YVHSVSEMVDKNDVEASINLLIKILEK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaatgtggaacttataaaaaagctaacacaggcttttggaccttcgggaagt
gaggagaaggtttttgagattataagagaggaagtcaaaggcttttgcgatgaaattact
catgatgcgatgggaaacatgatatgtgtgaaaaagggaaaagggaaaaagataatggtg
gctgctcatgctgatgaaataggcattatggttacgcatattgaagaggaaggcttcttg
aggtttacaacgataggtggcgtttatgtagagcatctggtgggaagaagagttgtgttt
aaaaatggtacagtaggagtgattggagtagaacatttggaagataaaaaggattttaaa
ctagaaaagctttatatagacataggagcaaaggataaaaaagaagctgaagagcttgtc
agaataggagatagtggggcttttgtaggggagtttgtagaagctggagataggttagtc
tccaaggcttttgacgacaggataggatgctatgtggcgattgaagcgctaaaaaacgtg
aagacagaaaatgagctgtattttgtcttcacagtgcaggaagaagtaggtttgagagga
gctactacagccgcttacagtattaatcctgattttgctattgctgttgatgttacagca
acgggagatactcctaaagcgaagaaaatggcggtggctctcggtaaaggtgcagcaata
aaggtaatggacagatcaataattgtgagcccttctgtgagagatatgatgattgaagtg
gcgaaagagaacaatattccgtatcaattagaaatactggaatttggcggtactgatgca
ggagcgattcacctttcaagagggggagtaccctctggagtgatttctattcccacaagg
tatgtccacagcgtttcagaaatggtggataaaaatgatgtggaggcaagtattaacctc
ctgataaaaatactggaaaaataa

DBGET integrated database retrieval system