KEGG   Thermoanaerobacter brockii: Thebr_1897Help
Entry
Thebr_1897        CDS       T01409                                 

Definition
(GenBank) Cellulase
Organism
tbo  Thermoanaerobacter brockii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1894848..1895867)
Genome map
AA seq 339 aa AA seqDB search
MLLKELTELLGASGDEKEVREKIKEIVKPYVDELYVDRIGNLIACKKGKKEKPKVMLAAH
MDEVALMVKSVNEDGTLSFSPVGGVDNRILVAKAVKVGEKKINGVIGAKPIHLQKKGEQE
KPLDFDELYIDIGAASKEEALKHVSPGDYVYFESNFELLGDGYVKAKALDDRIGCNVLIE
ILKNTYEYPVCAAFTVQEEVGLRGAGVAAYNVDPDFAIVVEGTVAADVVDSEPHLVSTEL
GKGPAISLMDRTTLYDRKIIDKIVKIAEKNKIPYQFRRIASGGNDAGKIHLTKGGIKTVA
ISVPCRYIHSFNSVAKLSDFENTVKLVDLVIKNIEEVLK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgctattaaaggagttaactgagcttttaggtgcttctggagatgaaaaagaggtaaga
gagaagataaaagagatagttaaaccttatgtggatgagctttatgtggatagaattgga
aatttgatagcctgcaaaaaagggaaaaaggaaaaaccaaaggtgatgctggctgctcac
atggatgaagttgctttaatggtgaagtctgtaaatgaagacgggacattaagtttttct
cctgtgggcggagttgacaaccgtattctggtagccaaagcagtaaaggtaggggagaag
aagataaacggggtaataggtgcaaaacctatacatcttcagaaaaaaggagagcaggaa
aaacctcttgactttgatgaactctatatagacattggagcagcatctaaagaagaagct
ttaaagcacgtttcacccggtgactatgtctactttgaatcaaattttgaacttttgggg
gatggatacgttaaggcaaaggctttagacgataggataggttgtaacgtgctgatagaa
attctgaagaatacatatgagtatcctgtttgtgcagcttttacagttcaagaagaagtt
ggtttaagaggcgcaggtgtagcagcttacaatgtagatcctgattttgcaatagtggta
gaaggcactgtcgctgcagatgttgtggattcagaacctcatttggtttctacagaacta
ggaaaaggaccagcgatttcacttatggatagaactactttgtatgatagaaagattatc
gataaaatcgtcaagatagcagaaaagaataagataccctatcagtttagaagaatagct
agcggtggtaatgacgcagggaaaattcaccttacaaagggaggaataaagacggtagct
atatctgtaccttgcaggtatattcattccttcaattctgtagctaagctgagtgacttt
gaaaatacagttaagcttgtggacttagtgattaaaaatattgaggaggtattgaaatga

DBGET integrated database retrieval system