KEGG   Thermoanaerobacter brockii: Thebr_2040Help
Entry
Thebr_2040        CDS       T01409                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thebr_2040
   01230 Biosynthesis of amino acids
    Thebr_2040
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thebr_2040
   00030 Pentose phosphate pathway
    Thebr_2040
   00051 Fructose and mannose metabolism
    Thebr_2040
  Energy metabolism
   00680 Methane metabolism
    Thebr_2040
Enzymes [BR:tbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Thebr_2040
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Thebr_2040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2038216..2039304)
Genome map
AA seq 362 aa AA seqDB search
MSKITLTVIKADVGGFVGHTDVHPELLEIAKKHLKEKGKMLIDFHVTRVGDDIELIMTHR
EGIDNEEVHKLAWDALWSCGEKAKELKLYGAGQDLLKDSFSGNIKGLGPGVAEMEIEERK
SEPVIIFMADKTEPGAWNLPLYKMFADPFNTVGLAIDPNMHQGFKFEVYDMIGHKKIIFE
TPEDIYDMLVFIGATGRYCIRRVYTKNNEIAAVSSTQRMNFMAGKYIGKDDPVLIVRCQN
GLPAVGEALEPFANPYLVAGWMRGSHNGPMIPVSLEDAVPTRFDGPPRVCALGFQLAEGK
LIGPQDFFKDVAFDNAREKALEIADYIRKMGPFEPHRLPLEELEYTTLPHVVKKLQGRWK
EE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaataactttaactgtgattaaagcagatgttggtggctttgtagggcataca
gacgtacatcctgaacttcttgaaatcgctaagaaacatttaaaagaaaaagggaaaatg
ctcattgactttcatgtgactagagtaggagatgacattgaacttataatgactcataga
gaaggaatagataacgaagaagttcataaacttgcatgggatgcactttggtcttgtggt
gagaaagctaaagaacttaaattgtacggtgcaggacaagatttgttgaaagattcattt
tcaggcaatataaaggggttaggaccgggagttgcagagatggaaattgaagaaagaaaa
agtgagcctgtcataatttttatggctgataaaacagagccaggagcatggaatttacca
ctttacaagatgtttgcagatccttttaatacagtaggacttgcaattgaccctaatatg
caccaaggatttaaatttgaagtttatgatatgattgggcataaaaaaataatatttgaa
actccagaagatatttatgatatgctggtctttattggagcgacaggacgatattgcata
cgaagagtgtatacaaaaaacaatgaaattgcagcagtgtcttctactcaaagaatgaat
tttatggcggggaagtatataggaaaggatgaccctgtacttattgtgagatgccaaaat
ggtcttccagcagtaggtgaagcgttggaaccttttgctaatccctatcttgttgctggt
tggatgagggggtctcataatggacctatgatacctgtttcattggaagatgctgtgcct
accagatttgatgggcctccaagagtatgcgcacttggttttcaattagcagagggtaag
cttattggcccgcaggacttctttaaagatgttgcttttgacaatgcaagggaaaaagcg
ttagaaatagccgattacataagaaagatgggaccctttgagcctcacaggttgccttta
gaggaattggaatacactaccctacctcatgttgttaaaaaacttcaagggagatggaag
gaagaataa

DBGET integrated database retrieval system