KEGG   Thermoanaerobacter brockii: Thebr_2201Help
Entry
Thebr_2201        CDS       T01409                                 

Definition
ROK familyglucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thebr_2201
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thebr_2201
   00052 Galactose metabolism
    Thebr_2201
   00500 Starch and sucrose metabolism
    Thebr_2201
   00520 Amino sugar and nucleotide sugar metabolism
    Thebr_2201
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thebr_2201
   00524 Butirosin and neomycin biosynthesis
    Thebr_2201
Enzymes [BR:tbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thebr_2201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2201693..2202640)
Genome map
AA seq 315 aa AA seqDB search
MGRILCGVDLGGTKISTGLVDEKGNIIRSTKIPTMAEKGPEEVIKRIEQSVYDVLKEAGL
KLSDLKGVGIGSPGPLDAKRGVVISPPNLPGWDNVPIVDILSHKLGVKVKLENDANAAAI
GEHLFGAGKGIDNFVYITVSTGIGGGVIIEGKLYSGENSNAAEIGHHTINFNGPRCNCGN
YGCFEAFASGTAIARFAQEGIQNGKDTMIRDLAKDGVVKSEHVFEAAKLGDEFAKELVDN
EAFYLGVGISNIMAFYNPKKIAIGGGVSTQWDMLYDKMMETIKKKALKPNAEVCEVVRAE
LGENVGVLGAAALLL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggggagaatcctatgcggtgttgacttaggagggacaaagataagcacaggactcgtg
gatgagaagggcaatatcataagaagcacaaaaatacctactatggctgaaaaagggcca
gaagaagtgattaagcgaatagaacaaagtgtttatgacgttttaaaagaagcaggatta
aaattatctgatttaaaaggagttgggattggatctccagggccccttgatgccaaaagg
ggggtagttataagcccacctaatcttccgggttgggacaatgtccctattgtggatatt
ttatctcataagctgggagttaaagtaaaattagagaatgatgcaaatgctgcagctatt
ggagaacatttatttggcgcaggaaaaggtatagacaattttgtttatataactgtaagt
actgggattggcggtggcgtgataatagaagggaaactttatagcggagaaaattctaat
gcagctgagattgggcaccatactataaattttaatggacctcggtgtaattgcggaaat
tatggatgttttgaggcttttgcttctggtacagctattgcgagatttgctcaagaggga
attcaaaatgggaaagatacaatgataagggatttagctaaggatggagtagtaaaatca
gaacatgtatttgaagcggcaaaattgggagatgagtttgcgaaagaattggttgacaat
gaagctttttatcttggagtgggaatttcaaatatcatggctttttataatccaaaaaaa
attgccataggtggtggcgtatccactcaatgggatatgctttatgataaaatgatggaa
acaataaagaaaaaagcattgaagcctaatgccgaggtttgtgaggtagtaagagctgaa
ttaggagaaaacgtgggagttttaggagcggcagcattactcttataa

DBGET integrated database retrieval system