KEGG   Trypanosoma brucei: Tb09.160.2360Help
Entry
Tb09.160.2360     CDS       T01013                                 

Definition
poly(A) export protein
Orthology
K14298  
mRNA export factor
Organism
tbr  Trypanosoma brucei
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Tb09.160.2360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 349 aa AA seqDB search
MFPFYSCDQGKGAHEVQSPPGDTISSIRFSPAGCPLLLVGATSWDKSCRVWQVDNSSRSA
AISSKPLSLAESGAPILDMSFSEDGRVFFGGCDKSATMWNLTTGQKTVVASHDLPISCLS
YVLSPTGGDMLITGSWDGKLRYWDMKQPRPVKEDLLGEPIFALDAQRSFPMAACVTGRKV
HVFNMQFMSKVMELDPPKMMKFSLRCVACSPQHDGVAVGSSEGRVSFIPLRQESGCTFKA
HVVEENNVFYMHQTNFCSIDSKTGRMITGGGDGRIAVWDYKKRCNVCYENDPKLPNRNNS
ISAGDISADCSLLAYARSYDWAMGKTRAITNEPHTIHIRSANPTQLKAR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtttccgttttactcatgcgaccagggtaaaggtgcacacgaggtgcaaagtccacca
ggtgataccataagctcgatccgtttctcccctgcaggatgtccgctgttgcttgtaggc
gcaacatcatgggacaaaagttgtcgtgtatggcaggttgataattcgtccagaagcgca
gccattagttccaaaccgttaagccttgcagaaagtggcgccccaattttggatatgtcg
ttttcggaagatggcagggtgttctttggtgggtgtgacaagagcgcaacgatgtggaat
ctaacgactggtcaaaaaaccgttgtcgcatcccacgaccttccgattagttgcctgtcc
tacgtgttgtcaccaaccggaggtgacatgttaataacaggaagttgggatggtaagtta
cgatactgggacatgaagcagccgcgacctgttaaggaggatttacttggtgagccgata
tttgcacttgatgcgcaaagatcgtttcctatggccgcatgcgtcaccggacgcaaagtg
cacgtttttaacatgcagtttatgtcgaaggtgatggaactggacccccccaaaatgatg
aagttcagtttacgatgtgttgcttgttcacctcagcatgatggggttgccgttgggagc
tcggaggggagggtatcgttcattcctttgagacaagaaagtggctgcacatttaaagct
catgtcgttgaagagaacaatgttttctatatgcaccaaacgaatttctgctcgatagat
tcgaagaccggacgaatgataactggtggtggggatggtcgcattgccgtctgggattat
aaaaagaggtgcaacgtatgctatgaaaatgatccgaagttgccaaacaggaataactcg
atttctgccggagacattagtgccgactgctctttgcttgcgtacgcacgtagctatgat
tgggcaatgggaaagacgcgcgcgattacgaacgagcctcatacaatacacataagatct
gctaatcctacacagctgaaagcaagatag

DBGET integrated database retrieval system