KEGG   Trypanosoma brucei: Tb09.160.4020Help
Entry
Tb09.160.4020     CDS       T01013                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Organism
tbr  Trypanosoma brucei
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 1342 aa AA seqDB search
MNQNNLSCEDSDVSTNPGNASPGSGDDSGTSSEGHPSCVDNSVSPSVSSLLSQAEKSATD
SVHAEEEHLEKDTELRQGMKQGGFVKSAGRGSKDPLALDQAVAPAIPVPFVGLINEGCTC
YLNSLLQMLFHLCYFRNAVYLTPTDANDESCSIPRALQSVFHEMEIRRTPVHTKKLTAAF
DWTESELYSQHDIQEMATLLRDNLEERMKGSVSEGAINRMFEGYGEQVVATLDKSFCSRS
RDTFYDIHLPLEGHTNLMDSLRSLTARDMLVGDNKYRVEEPGREPQYKDAQKSYEFRRFP
PVIWFHLKRFEMDLTSPILETKKVNSYLEFPVELSLEELEHETPSNWGEYATQVFAGDMG
DEKKMTGDDGGEKRKRRKGDNEVATAIARPFSRDTPAVYDLQGVIVHKGSVRSGHYYCYI
REWDATEKRFTRWLEFDDERVTVVSQEVAVNDNFGVPVPTEGRPLWHMPTNNAYMLSYVR
RADCQRMFERPKNNIVPQCVRDQLREEIQEEKRREEEANMRRRKLVLYVLTDEIISEHVK
RVQRETFPSDPRIWEEVCFRVEVEKTTPLQMVYVSVAECVPNVKKRFRFDDFRLWLSPWT
SHIHVAVPLQLTESTKNCSLTEYLNYRNDDKSPLMHFLVYLQRRTTLPQLYVPNTASLFV
NQRLGAEAVAACNGCTIILPKPTPISSITFYTIYFSDYAAPCNVHICLYAADDQKTPCES
KTCTLSRDLCMFDVNSTGQKIALIRCAVRGSLAWVYLLANERPSMSSLRVTYGCEGEGIE
ETNISSLPRIDRCAVLVFLKYFNPVTRHVAYAGSAMIPLHATVADCGRVLLRLLGEDPDL
VDTLLIYEESQCQNVLLDNEKTLQNSGIIVGSVLIAQQRNSRVHSYTDVNDYLLSLPNFI
HVKATHSVFEERYMFSEEDSGYEADNVEGSDDCVVPARPAVVEASIPMSDADSEVRGQTT
FYPPRNFHVIKAYMLTLDSQLKYDEVCEAIGTASGHDPAFIRLYKGTCGGNPNCGEILTP
EVDPAPSDMVLSGLLWGNRVDVIFFEVLREPRRVVECRPRLVVTVRGRKNEAIYKEKLVV
PQGTTVGDVVEQAVRRCAITVERTFCSDGGAGVALDAGGSVNRCSRSRSNNSEVISSQVI
TPFVISPHYLALVVDPRERLINCIIEVPVMEDGTCDCNCFIDDLVSQAVAAYGTAGLCAP
VEPLTIFVVPAPPLQKDQFRIACCHGEVFADRDDSLPLMFGQPFVVTADYHATVETLRDI
LLEYTGVPANEVVPLQRGVVVIATRRSVFLPWSECFFEFVRREERKRGPFTPSLLLNHRR
PREKPGSRYVAQAAPALRISRR
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagaacaatttatcttgcgaggacagtgatgtttccactaatcctggaaacgcc
tcaccaggttctggggatgatagcggaacatcttctgagggacatccgtcatgtgtggat
aattccgtgtcgccgtcggtatcttctctgttatcgcaagcggaaaagagcgccactgat
tcagttcatgcagaggaggagcacttggaaaaagatacggagttgagacaagggatgaaa
cagggagggtttgtaaagagcgctggacgcggaagcaaggatccgctcgcgcttgaccaa
gcagtggcacccgcgataccggtgccatttgttggtcttataaatgagggttgtacatgt
tacttgaactctcttcttcaaatgttgtttcacttatgctacttccgaaacgctgtttat
ctcacaccaacggacgctaatgatgagagttgctcgatacctcgtgcgctgcaatcagtt
ttccatgagatggagatacgccgtaccccagtgcatacaaaaaagttgacagccgccttc
gactggactgagagcgagctttactctcagcatgacattcaagaaatggccacgctgctt
cgtgacaatcttgaggagcgaatgaagggatctgtaagcgagggcgcgatcaaccggatg
tttgagggctatggtgagcaagttgttgcaacactcgacaagagcttttgttcacgcagc
cgggacaccttttacgatatccacctccccctcgaggggcacaccaacctcatggatagt
ttacgctcgctcacagcgagggacatgcttgttggggacaacaagtatcgcgttgaggaa
cctgggagggagccacaatataaggacgcacagaaaagttatgaattccgtcgctttcca
cctgttatttggtttcatttaaaacggttcgaaatggatctcacatcacctatactggag
acgaagaaggtgaacagttacttggagtttcccgtggagttgtccctcgaggaattggaa
cacgagactccctcaaattggggggaatacgctacccaagtatttgctggggatatgggt
gatgaaaagaaaatgacgggagatgatgggggtgagaagaggaagaggagaaaaggagat
aatgaagtggcaacggctattgcacggcccttcagtagggatacaccagccgtatatgat
ctgcagggagttattgtgcacaagggttctgtccgtagcggtcactactattgctacata
agggaatgggatgccactgagaagaggtttacgcgttggttggaatttgatgatgagagg
gtaacagttgtcagccaggaggttgcagtgaatgacaacttcggcgtgcctgttccaaca
gagggaaggccactctggcacatgcctactaataatgcttatatgctttcatatgtaaga
cgtgccgattgtcagaggatgtttgaacggccgaagaataacattgttcctcagtgtgta
agggatcaacttcgggaggaaatccaggaggagaaacgacgtgaggaggaggcaaacatg
cgtcgcagaaaattggtgctatacgtcctcacggatgaaataatcagtgagcatgtcaag
cgagtacaacgtgagacctttccatcagatcctcggatttgggaggaagtttgtttccgt
gtcgaagtagaaaaaactactccgcttcaaatggtgtatgtttctgtcgctgagtgcgta
ccgaacgttaaaaagaggttcaggtttgacgatttccgactctggctctctccgtggaca
agccacatccacgttgcggtgccgttgcaactgaccgaatcaactaagaattgctcactc
actgaatacctcaactataggaacgatgacaaatcaccactgatgcacttccttgtgtac
ctacaacgacggacaacacttccgcagctttatgtaccgaataccgcttcattgtttgtt
aatcaacggcttggggctgaggcggtggctgcgtgcaacggatgcaccattatcctcccc
aaaccaactcccatcagcagtattacgttctacacaatttacttttctgattatgcggcg
ccatgcaacgtgcatatttgcctgtacgctgctgatgatcaaaaaactccttgtgaaagc
aaaacatgtacactcagccgggacctatgcatgtttgacgtgaactccacggggcaaaaa
atcgcattaatccggtgcgctgtgagaggttcgctagcgtgggtctatttattagcaaac
gaaagaccctcaatgtcgtcgttacgggtgacatatgggtgtgaaggggaggggatcgaa
gaaactaacatttcgtctctcccccgtattgacaggtgtgctgttttggtctttctcaaa
tatttcaaccccgtcacccgccacgttgcctacgcaggatcggcgatgattccactgcac
gcaacagttgccgattgtgggcgagtgttgctacgtcttttgggtgaggaccctgactta
gttgatactcttctaatatatgaggaaagccagtgccaaaatgtactactcgataatgag
aagactctccagaactctggtatcatagttggtagtgtactgattgcgcaacaacgcaat
tcgcgtgtgcactcatatactgatgtaaacgactatctgcttagtttgccaaactttatc
catgtgaaggccacccattccgtctttgaggagcgctacatgttttcggaagaagactcg
ggttatgaggctgataatgttgaaggaagtgatgattgcgttgtaccagcaaggccagcc
gtcgtggaggcgtcaattcccatgtccgatgcggacagtgaggttcgcggacagacgacg
ttctacccaccaaggaactttcacgtcatcaaagcatatatgcttacattagatagccag
ttgaagtacgatgaggtctgtgaagcaattggtactgcaagcggacatgacccagctttc
attcggttgtacaaaggtacttgcggtggcaatcccaactgtggggagatattaacgcca
gaggtggaccctgcacccagcgatatggtcctttcagggttattgtggggtaaccgtgtg
gatgtcatcttttttgaggtactgcgcgagccacgacgcgtggtggagtgtcgcccgcgc
ctcgtagtgacggtacggggtcggaagaatgaggcaatatacaaggagaagcttgtggtt
ccacagggtaccacagttggtgatgtggtagaacaggcagttcggcgatgtgcgataact
gttgagcgcacattttgttctgacgggggagcaggggtcgccttggatgctggcggtagt
gtcaacagatgcagcagaagcagaagcaataacagtgaggtgataagttcacaggttatc
actccttttgtcatttcccctcactaccttgcacttgtcgtcgacccccgcgagcgtcta
atcaactgcatcatcgaagtgcccgttatggaagacggcacatgtgactgtaattgtttt
atcgatgacttggtttcacaagcggtggctgcatacggaaccgccggtctctgtgcccca
gtggagccactaacaatttttgttgtgcctgctccgccgctgcagaaggatcagttccgg
attgcttgctgtcatggtgaagtatttgctgaccgggatgacagtctcccactaatgttt
gggcagccttttgttgttacggcagattaccacgcaactgtagagacactgcgggatatc
ctccttgagtacacgggtgttcccgctaatgaagttgtgcctttacaacgtggtgttgtt
gtcatagccacaaggcgaagcgttttccttccttggagcgaatgtttctttgaatttgtg
aggcgggaagagagaaaaaggggtccattcactccgtcactgctgctaaaccaccgtcgg
ccgagagaaaaaccgggatcgcggtacgtggcgcaggctgctccggcgttacgtatttca
agaaggtga

DBGET integrated database retrieval system