KEGG   Trypanosoma brucei: Tb09.211.2360Help
Entry
Tb09.211.2360     CDS       T01013                                 

Definition
protein kinase A catalytic subunit isoform 2
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tbr  Trypanosoma brucei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 336 aa AA seqDB search
MPVATSTEPQTYVFTKPDTSGWKLSDFEMGDTLGTGSFGRVRIAKLKSRGEYYAIKCLKK
REILKMKQVQHLNQEKQILMELSHPFIVNMMCSFQDENRVYFVLEFVVGGEVFTHLRSAG
RFPNDVAKFYHAELVLAFEYLHSKDIIYRDLKPENLLLDGKGHVKVTDFGFAKKVTDRTY
TLCGTPEYLAPEVIQSKGHGKAVDWWTMGVLLYEFIAGHPPFFDETPIRTYEKILAGRFK
FPNWFDSRARDLVKGLLQTDHTKRLGTLKDGVADVKNHPFFRGANWEKLYGRHYHAPIPV
KVKSPGDTSNFESYPESGDKRLPPLAPSQQLEFRGF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtagccacgtcgacggaaccgcaaacgtatgtgtttaccaaacctgacacatcg
ggatggaagctgagtgactttgaaatgggtgacacgctagggaccggctcgtttggtcgc
gtgcgcattgcaaaactgaagagcaggggggagtattatgcaataaaatgtctaaagaag
cgtgagatactaaagatgaagcaggtacaacacctgaaccaagagaagcaaattctaatg
gagttgtcacaccccttcattgtgaacatgatgtgttccttccaggatgagaaccgcgtc
tactttgttctagaatttgtggtaggtggtgaggtatttactcaccttcgttccgcaggc
cgtttcccgaatgacgtagcgaagttctatcatgcggagcttgtgttggcctttgaatat
ttacactcgaaggacattatctaccgtgacttgaaacctgagaatctgctacttgatggg
aagggacacgtcaaggtgactgattttggttttgctaagaaggtgacggatcgtacctat
acgttatgtgggacacctgagtatcttgcacctgaggtaattcagagcaaaggacatggg
aaggctgtggattggtggacgatgggtgttttgctgtatgaattcatagctggccatcct
cccttttttgatgaaaccccaattcggacgtatgaaaagattcttgcgggccggttcaaa
ttccccaattggtttgactcccgtgcgcgggatctcgtaaagggtttattgcaaacggat
cacacgaaacggttgggcacgctgaaggatggcgtagctgatgtgaagaatcacccattc
ttccgtggtgcgaattgggagaaactctatggacgtcattatcacgctcccattcctgta
aaagtgaagagccccggcgacacaagtaactttgagtcgtatcccgagagtggggataag
cggttgcccccgttagcaccatcacaacaattggagttccgtgggttttag

DBGET integrated database retrieval system