KEGG   Trypanosoma brucei: Tb09.211.2410Help
Entry
Tb09.211.2410     CDS       T01013                                 

Definition
protein kinase A catalytic subunit isoform 1
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Tb09.211.2410
Protein kinases [BR:tbr01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Tb09.211.2410
Messenger RNA biogenesis [BR:tbr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Tb09.211.2410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 334 aa AA seqDB search
MTTTPTGDGQLFTKPDTSGWKLSDFEMGDTLGTGSFGRVRIAKLKSRGEYYAIKCLKKHE
ILKMKQVQHLNQEKQILMELSHPFIVNMMCSFQDENRVYFVLEFVVGGEVFTHLRSAGRF
PNDVAKFYHAELVLAFEYLHSKDIIYRDLKPENLLLDGKGHVKVTDFGFAKKVTDRTYTL
CGTPEYLAPEVIQSKGHGKAVDWWTMGVLLYEFIAGHPPFFDETPIRTYEKILAGRLKFP
NWFDERARDLVKGLLQTDHTKRLGTLKDGVADVKNHPFFRGANWEKLYGRHYNAPIAVKV
KSPGDTSNFESYPESGDKGSPPLTPSQQVAFRGF
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaactcccactggtgatggccaactgtttaccaagcctgacacatcgggatgg
aagctgagtgactttgaaatgggtgacacgctagggaccggctcgtttggtcgcgtgcgc
attgcaaaactgaagagcaggggggagtattatgcaataaaatgtctaaagaagcatgag
atactaaagatgaagcaggtacaacacctgaaccaagagaagcaaattctaatggagttg
tcacaccccttcattgtgaacatgatgtgttccttccaggatgagaaccgcgtctacttt
gttctagaatttgtggtaggtggtgaggtatttactcaccttcgttccgcaggccgtttc
ccgaatgacgtagcgaagttctatcatgcggagcttgtgttggcctttgaatatttacac
tcgaaggacattatctaccgtgacttgaaacctgagaatctgctacttgatgggaaggga
cacgtcaaggtgactgattttggttttgctaagaaggtgacggatcgtacctatacgtta
tgtgggacacctgagtatcttgcacctgaggtaattcagagcaaaggacatgggaaggct
gtggattggtggacgatgggtgttttgctgtatgaattcatagctggccatcctcccttt
tttgatgaaaccccaattcggacgtatgaaaagattcttgcgggccggcttaaattcccc
aattggtttgatgagcgtgcgcgggatctcgtaaagggtttattgcaaacggatcacacg
aaacggttgggcacgctgaaggatggcgtagctgatgtgaagaatcacccattcttccgt
ggtgcgaattgggagaaactctatggacgtcattataacgcccccattgccgtaaaagtg
aagagccccggcgacacaagtaactttgagtcgtatcccgagagtggagataagggttct
cctccactaaccccttcgcaacaggttgcattccgtggtttttag

DBGET integrated database retrieval system