KEGG   Trypanosoma brucei: Tb09.211.3570Help
Entry
Tb09.211.3570     CDS       T01013                                 

Definition
glycerol kinase glycosomal (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tbr  Trypanosoma brucei
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tbr00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 512 aa AA seqDB search
MKYVGSIDQGTTSTRFIIFDERQRPVSVHQVPHTQHTPHPGWLEHDPMEIFRSACKCMSV
AIAKLRQKDAFFRKIEAIGITNQRETTVAWDRVTKEPLCYAPVWNDLRTYDITKKVTAEL
GGGDSMFASKITGLPVSTYFAAFKMRWMLENVPAVADACRRGTLCFGTIDTWLMYKLSGG
KAFVTDVTNASRTFLMDLRTRKWSPELCENLKIPMETLPEIRSNSELFGYVETDECGVAA
ALNERTPIMGSIGDQQSALFGNMCFEKGEAKNTYGTGCFLLMNVGEEARFSKHGLLSTVG
FQVGRDGPCYYALEGAIACAGATVEWMRRNMNLFSHITECEKLARSVPGTQGIVFVPAFS
GLLAPYWDPSARGTIVGMTLKTTRAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVD
GGLSKNGLLMEIQASLLGVDILVPSMHETTALGAALCAGLAAGVWTSLEEVKAVSRRENS
WKTVSPSGSAMEREAMIAEWREALKRTKWAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgtcggatccattgaccagggaacaaccagcacccgcttcatcatcttcgat
gagcggcagcgccccgtctcggtgcaccaggttccccatacccagcacacaccccacccc
ggctggttggagcatgacccgatggagattttccgctccgcatgcaagtgcatgtccgtt
gccatcgcaaagctgaggcaaaaggacgcctttttccgcaagattgaggcgattggtatc
acgaaccaacgtgagacaacggtggcgtgggatcgcgttaccaaggaaccgctgtgctac
gcccctgtttggaatgacctgcgcacgtacgacatcaccaagaaggtgactgcggagctc
ggtggtggggattccatgttcgcatccaaaattactggcttgcctgtaagcacgtatttc
gctgcgttcaaaatgcggtggatgctcgagaatgttccagctgttgctgacgcatgccgt
cgtgggacgctttgcttcggcacgatcgacacatggctcatgtacaagctgagtggtggc
aaggcgtttgtgacagacgtgacgaacgcgtcacgcaccttccttatggatttgcgcacg
cggaaatggtctcctgaattgtgcgagaatctgaagatcccgatggaaacgctccccgag
attcgcagtaacagtgaactcttcggatatgtggagacggacgaatgcggtgttgcagct
gccctcaacgagaggacgcctattatgggcagtattggtgatcagcagtctgcgcttttc
ggaaatatgtgcttcgagaagggtgaggccaagaacacatacggcaccggctgcttcctg
ttgatgaacgtgggagaggaggcccgtttctcgaagcacggtttactttcgacagtgggc
ttccaggtgggccgcgatggaccatgctactatgcactggaaggcgcgatcgcgtgcgct
ggtgctacggtggagtggatgagaaggaacatgaacctcttcagtcatatcacagagtgt
gagaagttggcccgcagtgtccccgggacgcaaggtattgtctttgtgcccgccttctct
ggactgttggcgccctattgggatccatcggcccgtggtaccatcgtgggcatgacactc
aagacgactcgcgcgcacgtcatccgcgctgcgctgcaggccattgctctccagttgaac
gatgttgttggttcgatgaaacgtgacgctgggcttaacctgagctccctccgtgttgat
ggtgggttgtctaagaacggtctgctcatggagattcaagcaagtttgttgggcgtggac
atcttagtgccatcaatgcatgagacaactgcactcggtgcggcactgtgtgcaggactt
gcggctggtgtatggacttcattggaagaagttaaggctgtgtcgcgacgcgagaattcg
tggaagactgtcagccccagcggctctgccatggagcgtgaggcaatgatcgcagagtgg
cgcgaggcgctcaagaggacgaagtgggcaaagttgtag

DBGET integrated database retrieval system