KEGG   Trypanosoma brucei: Tb09.211.3590Help
Entry
Tb09.211.3590     CDS       T01013                                 

Definition
glycerol kinase glycosomal (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tbr  Trypanosoma brucei
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tb09.211.3590
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Tb09.211.3590
Exosome [BR:tbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tb09.211.3590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 512 aa AA seqDB search
MKYVGSIDQGTTSTRFIIFDERQRPVSVHQVPHTQHTPHPGWLEHDPMEIFRSACKCMSV
AIAKLRQKDAFFRKIEAIGITNQRETTVAWDRVTKEPLCYAPVWNDLRTYDITKKVTAEL
GGGDSMFASKITGLPVSTYFAAFKMRWMLENVPAVADACRRGTLCFGTIDTWLMYKLSGG
KAFVTDVTNASRTFLMDLRTRKWSPELCEKLKIPMETLPEIRSNSELFGYVETDECGVAA
ALNERTPIMGSIGDQQSALFGNMCFEKGEAKNTYGTGCFLLMNVGEEARFSKHGLLSTVG
FQVGRDGPCYYALEGAIACAGATVEWMRRNMNLFSHITECEKLARSVPGTQGIVFVPAFS
GLLAPYWDPSARGTIVGMTLKTTRAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVD
GGLSKNGLLMEIQASLLGVDILVPSMHETTALGAALCAGLAAGVWTSLEEVKAVSRRENS
WKTVSPSGSAMEREAMIAEWREALKRTKWAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgtcggatccattgaccagggaacaaccagcacccgcttcatcatcttcgat
gagcggcagcgccccgtctcggtgcaccaggttccccatacccagcacacaccccacccc
ggctggttggagcatgacccgatggagattttccgctccgcatgcaagtgcatgtccgtt
gccatcgcaaagctgaggcaaaaggacgcctttttccgcaagattgaggcgattggtatc
acgaaccaacgtgagacaacggtggcgtgggatcgcgttaccaaggaaccgctgtgctac
gcccctgtttggaatgacctgcgcacgtacgacatcaccaagaaggtgactgcggagctc
ggtggtggggattccatgttcgcatccaaaattactggcttgcctgtaagcacgtatttc
gctgcgttcaaaatgcggtggatgctcgagaatgttccagctgttgctgacgcatgccgt
cgtgggacgctttgcttcggcacgatcgacacatggctcatgtacaagctgagtggtggc
aaggcgtttgtgacagacgtgacgaacgcgtcacgcaccttccttatggatttgcgcacg
cggaaatggtctcctgaattgtgcgagaaactgaagatcccgatggaaacgctccccgag
attcgcagtaacagtgaactcttcggatatgtggagacggacgaatgcggtgttgcagct
gccctcaacgagaggacgcctattatgggcagtattggtgatcagcagtctgcgcttttc
ggaaatatgtgcttcgagaagggtgaggccaagaacacatacggcaccggctgcttcctg
ttgatgaacgtgggagaggaggcccgtttctcgaagcacggtttactttcgacagtgggc
ttccaggtgggccgcgatggaccatgctactatgcactggaaggcgcgatcgcgtgcgct
ggtgctacggtggagtggatgagaaggaacatgaacctcttcagtcatatcacagagtgt
gagaagttggcccgcagtgtccccgggacgcaaggtattgtctttgtgcccgccttctct
ggactgttggcgccctattgggatccatcggcccgtggtaccatcgtgggcatgacactc
aagacgactcgcgcgcacgtcatccgcgctgcgctgcaggccattgctctccagttgaac
gatgttgttggttcgatgaaacgtgacgctgggcttaacctgagctccctccgtgttgat
ggtgggttgtctaagaacggtctgctcatggagattcaagcaagtttgttgggcgtggac
atcttagtgccatcaatgcatgagacaactgcactcggtgcggcactgtgtgcaggactt
gcggctggtgtatggacttcattggaagaagttaaggctgtgtcgcgacgcgagaattcg
tggaagactgtcagccccagcggctctgccatggagcgtgaggcaatgatcgcagagtgg
cgcgaggcgctcaagaggacgaagtgggcaaagttgtag

DBGET integrated database retrieval system