KEGG   Trypanosoma brucei: Tb09.211.4110Help
Entry
Tb09.211.4110     CDS       T01013                                 

Definition
NADPH--cytochrome p450 reductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Tb09.211.4110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 690 aa AA seqDB search
MFRRFCTASGILAGTCLVAFAVRVWVTRRGCLPNERSLSAKYANMLQNGQASKGCQTYQD
EAILVIYGSVSGNAEMYAKTLVTNLRERGADIALIDPSAWPYLAQHTPQQPLFPASKGTQ
MPVVVFVVSTTGEGEVPDNFFSLFIQMKAVVRRGLEEGAEPFKDVFYAVFALGESSYKYF
CRAGVDVDGLLQKGGGTELVPIGIGDARDPLRDDLFDAWEETLTKKLEETCGMKLEALSD
KPPQPQLLFRFIPDKPADTLPFAPPPSLLEPSGQYPGQFVLEAKTRRTSEREDGSYVLHL
VLGFGGHTVKYQAGDHLGIYPANPPDVVEAYRQVLNIPLTDWTKPVELCSPVNARARASL
RNTLPARVTLRTVFERYLDLCGKPRKSMLRLLARYCSEIEEKTAMIDFLRGGHSLNAVAE
FGTSTPSYRRGHYTVLDCLKMFCSWRGRLPVGHFVEAMPRMQPRFYSIASDMLTHPTTVE
AFIRIIPDGVNSLFLHHLSVGAKVTAFVRKSTFHLPQKCSGRPVVMIGPGTGVASMIGFC
YRREAMLKKQAAVEHGPMVLFFGNRNRSSEYFVEREVRQWCPHGEGKLPSAGVRCDSVLT
LVDAAFSRDQPEKYYVTHLLEKHQDYLLKLLTSRVGGGCLIYISGDASRVSRSVDKAILK
LLEYGGFAEEAAVEFLARMEREGRYLKDVY
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtcggttctgcaccgcatctggtatcctcgcggggacgtgcctagtggccttt
gcggtgcgcgtatgggttacgcggaggggttgtctgcccaatgaacggtcactctcggcc
aaatacgcgaatatgctgcagaacgggcaagcgagcaaggggtgccaaacttatcaggac
gaagcgatattagtgatctacggaagtgtttctggaaatgctgaaatgtatgccaagacc
ctcgtgaccaatctgcgagaacggggtgctgacatcgcactcattgacccttccgcgtgg
ccttatcttgctcaacatactcctcaacaaccactttttccagcaagtaaaggcacccag
atgcccgtagtggtgtttgttgtgtcaaccacaggtgaaggggaggtgcctgacaacttt
ttctccctcttcatacaaatgaaggcggtggtgcgcaggggtttggaagaaggtgctgag
ccgtttaaggacgtcttctacgccgtgttcgctttgggggagagttcgtacaagtatttc
tgccgggcgggggttgatgtcgatgggctactgcaaaagggtggaggaacggaactggtt
cctattggtatcggcgacgcacgtgaccctctgagggatgatcttttcgacgcgtgggag
gagactctcacgaagaaacttgaagaaacatgcggaatgaaactggaggcgttgtcggac
aaaccaccacaaccacagttactgttccgcttcataccggataaaccagcggatacactg
ccttttgctccaccaccgtcgttgctggaaccgtctggacaatatccggggcagtttgtg
ttggaagccaaaacgaggcgaacgagcgagcgagaagatggctcctatgtgctgcatctc
gtattgggctttggcggtcacactgtaaagtatcaggcgggtgaccatttgggaatttac
cccgctaatccacctgatgtagttgaagcttataggcaggttttgaacatccccttgacg
gactggacaaagccagtggagttgtgctcgcccgttaatgcacgcgctagagcttcgttg
cgaaatactcttcctgcgcgtgtaacactgagaacggtgttcgagcggtacctggatttg
tgtggcaaacctcggaagtccatgttgcgcctcctggcaaggtactgctcggaaattgag
gaaaaaacagcaatgattgattttcttcgtggaggacattctctcaatgctgtagcagag
tttggaacatcgacaccatcctaccgcagaggccattataccgttctggattgcctgaaa
atgttttgtagttggcgtggaaggcttcctgtcgggcactttgtggaagcgatgccacga
atgcaacccaggttctattctattgcatcggatatgttaacgcaccccacgacagtggag
gcattcatccgcatcattccggatggcgtaaactccttatttcttcaccacctttccgtt
ggagccaaagtaaccgcatttgttcgcaagtcaacgtttcacctcccccaaaagtgtagc
gggcgcccggtggtgatgatcggtcctggaaccggcgttgcttcaatgatcggtttctgc
tacagacgggaggcgatgctgaagaagcaagctgcggtcgaacatgggcccatggttctc
ttctttggtaatcgaaaccgctcatcggaatattttgtggagcgtgaggtgcgccaatgg
tgtccacacggtgaggggaaacttccttctgccggtgtacgctgtgactccgtgttgaca
ctagttgatgctgcattcagccgggatcaacctgagaagtactatgtcacacaccttttg
gagaaacaccaagattacctcctgaaactcttgaccagtcgcgtgggcggtggttgtctt
atttacatttcgggtgatgcatcacgggtatcgcgtagcgtggacaaggcaatattaaag
ttgctggagtatggtggattcgccgaagaggcagcagttgagttcctggcgaggatggag
cgggaaggtagatacttgaaggacgtgtactga

DBGET integrated database retrieval system