KEGG   Trypanosoma brucei: Tb09.211.4270Help
Entry
Tb09.211.4270     CDS       T01013                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Tb09.211.4270
Peptidases [BR:tbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Tb09.211.4270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 445 aa AA seqDB search
MRAEIPGVVPAVVSQVSEHQLPHLYPRHTAVTDSTALPREKSTLQRTDTTDSQLFSLADL
QLARGNTRRPSRSRPTSPIRKDRIPRPPSVEFDVHLEVPRPHIRVSALPKHVMWPLPIPL
PNLGNTCYMNSVVQCLRQSPSLALALEQCQLNAESHPAAAAMLNFFRMSEGDPKEFLVTF
KSEAAKYNDEFKDFTQADAHEFLRTFLSVVHNEINTAPRAKLHIDDMGYVGKEDEETAFG
MWRDQFACFDKSPIYDLFGGTTLGTCFCNSCENSSRTFEAFLDLSLPIGHEMPFGANLEA
ILQANFVEGKAEKMDGSNRIYCSRCKRLRSGSRCVVVRQWPKLLVLHLKRFDEYGKKNLV
NVIYPETFMTGGEKSLRYSLYGVLMHSGTEMSGHYTSYVRVAFGEWYLCNDGAITPSRSV
DVMQELEKAYILFYAEVPQVEPTFF
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcggagattcccggtgttgtccctgcggtggtgtcacaggtgtcggaacatcaa
ctgccgcatttatacccccggcacactgccgtaaccgatagtactgcactcccacgtgag
aaaagtacattgcagcggactgacacaactgactctcagttgttttcgttggcggatctt
cagctggcgcgtggaaacacccggcggccgtcccgtagtcgaccgactagtccgattagg
aaagatagaatcccacgcccgccttcagtcgaatttgatgttcatctagaggtgcctagg
ccgcacatccgtgtttcggcgttgccaaaacatgtcatgtggccactgccaattccgctt
ccaaatttaggtaacacatgttatatgaattcggtggtgcagtgtcttcgacagagcccg
tcgttggctctcgccttagagcagtgccagttgaatgctgaatcacatccggcagcggcg
gcgatgctgaacttctttaggatgtcggaaggggacccaaaggaatttctcgttaccttc
aaatccgaagcagcgaagtacaatgatgaatttaaggatttcactcaagcggatgcgcat
gagtttcttagaaccttcctttcggtagtgcacaatgaaatcaataccgcacctcgcgct
aagttgcacattgatgatatgggttatgttggcaaggaggatgaggagacagcgttcggg
atgtggcgtgatcagttcgcatgtttcgacaaatctcccatttacgatctctttggggga
accacgcttgggacttgtttctgtaacagctgcgaaaattcttcaaggacctttgaagcg
tttttggatctttcattacctataggacacgaaatgccatttggtgccaatcttgaggcc
attcttcaggctaactttgtggaaggtaaagcggagaaaatggatggaagtaatcgtatt
tactgctcacgatgcaaacgccttcgctcgggaagccgatgtgttgtcgtgaggcaatgg
ccaaagttattagtcttgcatttgaaacgatttgacgagtatgggaagaagaatcttgta
aatgtcatataccccgaaaccttcatgacaggtggggagaaatcattgcgatatagtttg
tatggcgtattgatgcatagcggtacggagatgtctggacattacacaagttatgtgcgt
gtggcgtttggcgagtggtacctttgtaatgatggagcaattacaccttcgcggtctgtc
gatgtaatgcaagaacttgagaaggcgtatattctcttttatgcagaggtacctcaggtt
gaaccaacttttttttga

DBGET integrated database retrieval system