KEGG   Trypanosoma brucei: Tb10.26.0200Help
Entry
Tb10.26.0200      CDS       T01013                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tbr  Trypanosoma brucei
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tb10.26.0200
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Tb10.26.0200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 178 aa AA seqDB search
MGAYPNRFGFSVSHTTRAPREGEVHGREYFFSTRESMLTMEKEGKFIELCDVHGNLYGTS
IDAVKEVQSTGKVCVIDMDVKGAQKLRASGYLKNVLYLFVTVPSIDVLRARIQKRGALSE
EVLQRRIATAEVELHFLGENPTFFSHVITNEELEVSYKKLCEIVGSEFLKYGMEGLNK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcttatccgaatcgctttggattttccgtatcacacacgacgcgtgctccccgt
gagggtgaggtgcacggccgtgagtacttcttctcgactcgtgagagcatgctcacaatg
gagaaagagggaaagttcattgaactatgtgatgttcacggaaacttgtatggcaccagc
attgatgcggttaaggaggttcaaagtaccggcaaggtgtgtgtcattgacatggacgtg
aagggcgcgcagaagctgcgagcgagcggttacttgaagaatgtactttatttgtttgtc
acggtgccatcaatcgatgttctgcgcgcgcgaattcaaaagcggggtgcattgagtgag
gaagtgcttcagcggcgcattgcaaccgctgaggtggagttgcactttttgggggaaaat
cctacctttttttcccacgtcatcacaaatgaggagttggaggtatcgtacaaaaaactg
tgcgaaatcgttgggagcgagtttctgaaatatggtatggaggggttaaataagtga

DBGET integrated database retrieval system