KEGG   Trypanosoma brucei: Tb10.389.0330Help
Entry
Tb10.389.0330     CDS       T01013                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase 2 (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tbr  Trypanosoma brucei
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tb10.389.0330
   00052 Galactose metabolism
    Tb10.389.0330
   00500 Starch and sucrose metabolism
    Tb10.389.0330
   00520 Amino sugar and nucleotide sugar metabolism
    Tb10.389.0330
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tb10.389.0330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
10
AA seq 485 aa AA seqDB search
MPLNPPSAFSGAALACLEKMQASGVEEKCIHIFLIQHALVRKGETGYIPEKSIFPVESLP
FLQGIETKGENTALLRQAVVLKLNGGLGTGMGLNGPKSLLQVKNGQTFLDFTALQLEHFR
QVRNCNVPFMLMNSFSTSGETKNFLRKYPTLYEVFDSDIELMQNRVPKIRQDNFFPVTYE
ADPTCEWVPPGHGDVYTVLYSSGKLDYLLGKGYRYMFISNGDNLGATLDVRLLDYMHEKQ
LGFLMEVCRRTESDKKGGHLAYKDVIDETTGQTRRRFVLRESAQCPKEDEDSFQNIAKHC
FFNTNNIWINLMELKKMMDEQLGVLRLPVMRNPKTVNPQDSQSTKVYQLEVAMGAAISLF
DRSEAVVVPRERFAPVKTCSDLLALRSDAYQVTEDQRLVLCEERNGKPPAIDLDGEHYKM
IDGFEKLVKGGVPSLRQCTSLTVRGLVEFGADVSVRGNVVIKNLKEEPLIIGNGRVLDNE
VVVVE
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgccgctaaaccctccttcagccttttcaggggcagctttggcctgcttggaaaaaatg
caggcatcaggtgttgaggagaagtgtattcatattttcctcatccaacacgctcttgtc
cggaaaggagaaaccggctatatacccgagaagtcaatatttccggtggaatctcttccc
ttccttcagggtatcgaaacgaagggagaaaacactgcgttactgcgacaagcggtcgtt
cttaaactcaacggcggtcttggtaccgggatggggttgaacggccccaagagcctgcta
caggtgaagaatggccagacgtttcttgacttcacagccctgcagttggagcattttcgt
caagtgcgtaactgtaacgtgccgtttatgctgatgaactcgttttccacatcgggagaa
actaagaattttcttcggaagtatcctaccttgtacgaggtgtttgactcagacatcgaa
ctcatgcaaaacagagtgcccaagataaggcaagacaatttctttcccgtcacctacgag
gctgacccaacgtgcgagtgggtaccaccaggacacggggacgtatatacggtgctttac
agtagtggtaagttggattacctgttgggcaaaggctaccgctacatgtttatatcaaac
ggagacaaccttggcgcgacactagatgtgaggcttctggactatatgcacgaaaaacag
ctggggtttctcatggaggtgtgtcgccgtacggagtcagacaaaaagggaggccacttg
gcgtacaaggatgtcattgacgagactactggacaaacgcgacgacgttttgttcttcgc
gaatctgctcagtgtccaaaagaagatgaggatagctttcaaaacatcgcgaagcactgt
ttctttaatacgaacaacatttggataaatctcatggaattgaagaagatgatggacgag
cagttgggagtgctgcggcttccagtgatgcgaaaccccaagacggtgaacccgcaggac
agtcaatcaacgaaggtgtaccagctggaggtggcgatgggtgccgcaatttctctattt
gatagatcggaagcagtagtggttccaagggagcggtttgcacctgtgaagacttgcagt
gatctacttgcgttaaggtctgatgcgtatcaggtgacggaggatcagcgtcttgttctg
tgtgaggagcgaaatggaaagccaccagctattgatcttgacggtgagcattacaagatg
attgacggattcgaaaagcttgtgaagggaggagtgccatccttgcgacaatgcacatca
cttaccgtccgtggattggtggaatttggtgccgacgtttccgttagagggaatgtggtt
attaaaaatttgaaggaagagcctctgatcattgggaacggacgcgttcttgacaatgag
gttgtggtagtcgagtag

DBGET integrated database retrieval system