KEGG   Trypanosoma brucei: Tb10.389.0330Help
Entry
Tb10.389.0330     CDS       T01013                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase 2 (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tbr  Trypanosoma brucei
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tbr00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tbr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tbr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tbr00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
10
AA seq 485 aa AA seqDB search
MPLNPPSAFSGAALACLEKMQASGVEEKCIHIFLIQHALVRKGETGYIPEKSIFPVESLP
FLQGIETKGENTALLRQAVVLKLNGGLGTGMGLNGPKSLLQVKNGQTFLDFTALQLEHFR
QVRNCNVPFMLMNSFSTSGETKNFLRKYPTLYEVFDSDIELMQNRVPKIRQDNFFPVTYE
ADPTCEWVPPGHGDVYTVLYSSGKLDYLLGKGYRYMFISNGDNLGATLDVRLLDYMHEKQ
LGFLMEVCRRTESDKKGGHLAYKDVIDETTGQTRRRFVLRESAQCPKEDEDSFQNIAKHC
FFNTNNIWINLMELKKMMDEQLGVLRLPVMRNPKTVNPQDSQSTKVYQLEVAMGAAISLF
DRSEAVVVPRERFAPVKTCSDLLALRSDAYQVTEDQRLVLCEERNGKPPAIDLDGEHYKM
IDGFEKLVKGGVPSLRQCTSLTVRGLVEFGADVSVRGNVVIKNLKEEPLIIGNGRVLDNE
VVVVE
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgccgctaaaccctccttcagccttttcaggggcagctttggcctgcttggaaaaaatg
caggcatcaggtgttgaggagaagtgtattcatattttcctcatccaacacgctcttgtc
cggaaaggagaaaccggctatatacccgagaagtcaatatttccggtggaatctcttccc
ttccttcagggtatcgaaacgaagggagaaaacactgcgttactgcgacaagcggtcgtt
cttaaactcaacggcggtcttggtaccgggatggggttgaacggccccaagagcctgcta
caggtgaagaatggccagacgtttcttgacttcacagccctgcagttggagcattttcgt
caagtgcgtaactgtaacgtgccgtttatgctgatgaactcgttttccacatcgggagaa
actaagaattttcttcggaagtatcctaccttgtacgaggtgtttgactcagacatcgaa
ctcatgcaaaacagagtgcccaagataaggcaagacaatttctttcccgtcacctacgag
gctgacccaacgtgcgagtgggtaccaccaggacacggggacgtatatacggtgctttac
agtagtggtaagttggattacctgttgggcaaaggctaccgctacatgtttatatcaaac
ggagacaaccttggcgcgacactagatgtgaggcttctggactatatgcacgaaaaacag
ctggggtttctcatggaggtgtgtcgccgtacggagtcagacaaaaagggaggccacttg
gcgtacaaggatgtcattgacgagactactggacaaacgcgacgacgttttgttcttcgc
gaatctgctcagtgtccaaaagaagatgaggatagctttcaaaacatcgcgaagcactgt
ttctttaatacgaacaacatttggataaatctcatggaattgaagaagatgatggacgag
cagttgggagtgctgcggcttccagtgatgcgaaaccccaagacggtgaacccgcaggac
agtcaatcaacgaaggtgtaccagctggaggtggcgatgggtgccgcaatttctctattt
gatagatcggaagcagtagtggttccaagggagcggtttgcacctgtgaagacttgcagt
gatctacttgcgttaaggtctgatgcgtatcaggtgacggaggatcagcgtcttgttctg
tgtgaggagcgaaatggaaagccaccagctattgatcttgacggtgagcattacaagatg
attgacggattcgaaaagcttgtgaagggaggagtgccatccttgcgacaatgcacatca
cttaccgtccgtggattggtggaatttggtgccgacgtttccgttagagggaatgtggtt
attaaaaatttgaaggaagagcctctgatcattgggaacggacgcgttcttgacaatgag
gttgtggtagtcgagtag

DBGET integrated database retrieval system