KEGG   Trypanosoma brucei: Tb10.389.0330Help
Entry
Tb10.389.0330     CDS       T01013                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase 2 (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tbr  Trypanosoma brucei
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tb10.389.0330
   00052 Galactose metabolism
    Tb10.389.0330
   00500 Starch and sucrose metabolism
    Tb10.389.0330
   00520 Amino sugar and nucleotide sugar metabolism
    Tb10.389.0330
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tb10.389.0330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
10
AA seq 485 aa AA seqDB search
MPLNPPSAFSGAALACLEKMQASGVEEKCIHIFLIQHALVRKGETGYIPEKSIFPVESLP
FLQGIETKGENTALLRQAVVLKLNGGLGTGMGLNGPKSLLQVKNGQTFLDFTALQLEHFR
QVRNCNVPFMLMNSFSTSGETKNFLRKYPTLYEVFDSDIELMQNRVPKIRQDNFFPVTYE
ADPTCEWVPPGHGDVYTVLYSSGKLDYLLGKGYRYMFISNGDNLGATLDVRLLDYMHEKQ
LGFLMEVCRRTESDKKGGHLAYKDVIDETTGQTRRRFVLRESAQCPKEDEDSFQNIAKHC
FFNTNNIWINLMELKKMMDEQLGVLRLPVMRNPKTVNPQDSQSTKVYQLEVAMGAAISLF
DRSEAVVVPRERFAPVKTCSDLLALRSDAYQVTEDQRLVLCEERNGKPPAIDLDGEHYKM
IDGFEKLVKGGVPSLRQCTSLTVRGLVEFGADVSVRGNVVIKNLKEEPLIIGNGRVLDNE
VVVVE
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgccgctaaaccctccttcagccttttcaggggcagctttggcctgcttggaaaaaatg
caggcatcaggtgttgaggagaagtgtattcatattttcctcatccaacacgctcttgtc
cggaaaggagaaaccggctatatacccgagaagtcaatatttccggtggaatctcttccc
ttccttcagggtatcgaaacgaagggagaaaacactgcgttactgcgacaagcggtcgtt
cttaaactcaacggcggtcttggtaccgggatggggttgaacggccccaagagcctgcta
caggtgaagaatggccagacgtttcttgacttcacagccctgcagttggagcattttcgt
caagtgcgtaactgtaacgtgccgtttatgctgatgaactcgttttccacatcgggagaa
actaagaattttcttcggaagtatcctaccttgtacgaggtgtttgactcagacatcgaa
ctcatgcaaaacagagtgcccaagataaggcaagacaatttctttcccgtcacctacgag
gctgacccaacgtgcgagtgggtaccaccaggacacggggacgtatatacggtgctttac
agtagtggtaagttggattacctgttgggcaaaggctaccgctacatgtttatatcaaac
ggagacaaccttggcgcgacactagatgtgaggcttctggactatatgcacgaaaaacag
ctggggtttctcatggaggtgtgtcgccgtacggagtcagacaaaaagggaggccacttg
gcgtacaaggatgtcattgacgagactactggacaaacgcgacgacgttttgttcttcgc
gaatctgctcagtgtccaaaagaagatgaggatagctttcaaaacatcgcgaagcactgt
ttctttaatacgaacaacatttggataaatctcatggaattgaagaagatgatggacgag
cagttgggagtgctgcggcttccagtgatgcgaaaccccaagacggtgaacccgcaggac
agtcaatcaacgaaggtgtaccagctggaggtggcgatgggtgccgcaatttctctattt
gatagatcggaagcagtagtggttccaagggagcggtttgcacctgtgaagacttgcagt
gatctacttgcgttaaggtctgatgcgtatcaggtgacggaggatcagcgtcttgttctg
tgtgaggagcgaaatggaaagccaccagctattgatcttgacggtgagcattacaagatg
attgacggattcgaaaagcttgtgaagggaggagtgccatccttgcgacaatgcacatca
cttaccgtccgtggattggtggaatttggtgccgacgtttccgttagagggaatgtggtt
attaaaaatttgaaggaagagcctctgatcattgggaacggacgcgttcttgacaatgag
gttgtggtagtcgagtag

DBGET integrated database retrieval system