KEGG   Trypanosoma brucei: Tb10.389.1730Help
Entry
Tb10.389.1730     CDS       T01013                                 

Definition
protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Tb10.389.1730
Protein kinases [BR:tbr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   Tb10.389.1730
Exosome [BR:tbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tb10.389.1730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 413 aa AA seqDB search
MNRSSRNLAEMQDEINQLDDRYKLEKIIGAGSYGVVIRARDTTTNDLVAIKRVNKEIFEE
IILAKRILREIKLLAHFHHDNIIGLRNLITPADRDNYDYFYIVMDVMETDLKQVLRTGQS
LTEGHIQYFIYQILHALNFIHSSGVIHRDITPANILVNKNCDLKICDFGLSKEESDQGEH
MTDYVTMRWYRAPELVMEDKRYSAQIDVWGVGSILGELLGARPLFQGKDRVNQLDKIIDV
IGTPSEEDINSIGSTAAQKYLKKKSFRPAPDWASVYPRASPEALDLLRRMLVFHPDKRIT
VAEALKHPFLRDLYEESDVQVSIQHFNFDETQHKTIQEVKWAVYDESVAFHKNHPRTAPR
PQQQQHSAQQPAAAASLPTVDIAGEWRSAQQTIERGEEECGAEQFDKYVGSVE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtagttcgaggaaccttgcagagatgcaggatgagatcaaccagttggacgac
cgttacaaacttgaaaagataattggtgcgggatcctatggtgtcgtcatccgcgcgagg
gataccacaacaaacgacctagtggccattaaacgcgtcaataaggaaatattcgaggaa
ataatccttgcaaaacgtattcttcgcgaaatcaagctgttggcacactttcaccacgat
aatatcattggactccgtaacctcatcaccccggccgaccgcgacaactatgattacttt
tatattgtcatggatgtaatggagaccgacctgaagcaagtgctccgaactggccaaagt
ctcacggaaggtcacatacaatatttcatttatcaaatcttacatgccctaaacttcatc
cattcttcaggtgttattcatcgagacatcaccccggccaacattttagtcaataaaaat
tgtgatttgaagatatgcgacttcggactttccaaagaggagagtgatcaaggggagcac
atgacagattatgttaccatgcgttggtaccgtgcaccggagctggtgatggaagataag
aggtattccgcacaaattgatgtgtggggagttggaagtattcttggtgagttgctgggc
gcccgacccctgtttcagggaaaagaccgtgtgaaccaactggacaaaatcattgatgtt
atcggaactccatctgaagaggatataaattccatcgggtccactgcggcgcagaagtat
ttaaaaaagaagtcatttcgtcctgcacccgattgggcctccgtatatcccagagcgagt
ccagaggcgctggacttattgcggcggatgttggtgttccatccagacaagcgcataact
gtcgctgaagcattaaaacatcccttccttagggatctgtacgaggaatccgatgtacag
gttagtatccagcactttaactttgatgaaacacaacataaaacaattcaggaggtaaag
tgggcggtgtatgatgagagtgtggcatttcacaaaaaccacccccggacagcacctagg
ccacaacaacaacaacattctgcgcaacaacccgccgctgctgcatctcttccaactgtt
gatatcgctggagagtggcggtcagcgcaacaaacaattgagcggggcgaggaggaatgt
ggtgcggagcagttcgacaaatatgtgggttccgttgagtga

DBGET integrated database retrieval system