KEGG   Trypanosoma brucei: Tb10.389.1850Help
Entry
Tb10.389.1850     CDS       T01013                                 

Definition
NAD or NADP dependent oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
tbr  Trypanosoma brucei
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Tb10.389.1850
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Tb10.389.1850
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Tb10.389.1850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 260 aa AA seqDB search
MLSGKVALVTGSTSGIGFGIARQLAAAGADILLNGKESSLRDASLLENLEKYGRRVRYFG
ADNRCRPALEDMVKYAEDELGKVDILVNNAGIQHVASVTTLPAEKWNDVISINLSASFHT
IQLCLPRMQQRGWGRIINISSVHGIVGSANKAAYCAAKHGLLGLTKAVALEVATTGVTCN
AVCPGYVRTPLVEVQVKAIADAKFNGDIEAAKVELLREKQPSKSFITVEQVGDVVLWLAN
PSSSQINGSNITVDGGWTAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgttatcaggaaaggtggcgcttgttactggatcgaccagtggtatcgggtttggaatt
gcgaggcagctggcggcagctggtgccgacattctcctcaacggaaaagaatcttccctg
agggacgcgagtttgttggaaaacttggaaaagtacgggcgacgtgttcgctactttggt
gcggataacaggtgcagaccggccctcgaggatatggtgaagtatgcagaggacgagctt
ggcaaagtggatattctggttaataacgcggggatacagcatgtcgcatccgtgactaca
ctcccagcggagaaatggaatgatgtcatctctataaaccttagtgcatctttccacacc
atacaactttgcctaccgcgcatgcaacaacggggttggggccggataatcaacatttct
tccgtccatggcatagttggttcggctaataaagcggcgtactgcgctgccaagcatggg
ttactcggtcttactaaagcagttgcactagaggtcgcgacaacaggcgtcacttgcaac
gccgtgtgccccggctatgttcgcacacctttagttgaggtgcaagtgaaggccatcgcc
gatgcaaagtttaatggagatattgaagccgcgaaagttgagcttctgcgggaaaagcaa
ccttcaaagagcttcataacagttgaacaggttggggatgttgtactgtggctcgcgaat
ccgtcttccagtcaaatcaacggctcaaacattacagtggacggtggctggacagcacag
tag

DBGET integrated database retrieval system