KEGG   Trypanosoma brucei: Tb10.406.0340Help
Entry
Tb10.406.0340     CDS       T01013                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
tbr  Trypanosoma brucei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 112 aa AA seqDB search
MATPKSTPAKTHKEAKKTRRQRKRTWNVYVSRSLRSINNQMSMTSRTMKIVNSFVNDLFE
RIAAEAATIVRVNRKRTLGARELQTAVRLVLPADLAKHAMAEGTKAVSHASS
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggccactcctaagagcacaccggctaagacgcacaaggaggcgaagaagacgcggcgc
cagcgcaagcgcacatggaacgtctacgtcagccgctcactccgctcgatcaacaaccag
atgtcgatgaccagccggacgatgaagatcgtgaactcatttgtgaacgacctgtttgag
cgcattgctgcagaggctgctacgatcgtgcgtgtgaaccgaaagcggaccctgggcgct
cgcgagttgcagacggctgtgcgccttgtgctgcctgctgacctcgcgaagcacgcgatg
gcagaggggacgaaggctgtgtcacacgcttccagctaa

DBGET integrated database retrieval system