KEGG   Trypanosoma brucei: Tb10.406.0410Help
Entry
Tb10.406.0410     CDS       T01013                                 

Definition
(RefSeq) histone H2B, putative
  KO
K11252  histone H2B
Organism
tbr  Trypanosoma brucei
Brite
Chromosome and associated proteins [BR:tbr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Tb10.406.0410
Exosome [BR:tbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tb10.406.0410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone GMP_synt_C CBFD_NFYB_HMF ClpB_D2-small
Motif
Other DBs
NCBI-GeneID: 3662875
NCBI-ProteinID: XP_823271
UniProt: Q389T1
Position
10
AA seq 112 aa AA seqDB search
MATPKSTPAKTRKEAKKTRRQRKRTWNVYVSRSLRSINSQMSMTSRTMKIVNSFVNDLFE
RIAAEAATIVRVNRKRTLGARELQTAVRLVLPADLAKHAMAEGTKAVSHASS
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggccactcctaagagcacaccggccaagacgcgcaaggaggcgaagaagacgcggcgc
cagcgcaagcgcacatggaacgtctacgtcagccgctcactccgctcgatcaacagccag
atgtcgatgaccagccggacgatgaagatcgtgaactcatttgtgaacgacctgtttgag
cgcattgctgcagaggctgctacgatcgtgcgtgtgaaccggaagcggaccctgggcgct
cgcgagttgcagacggctgtgcgccttgtgctgcctgctgacctcgcgaagcacgcgatg
gcagaggggacgaaggctgtgtcacacgcttccagctaa

DBGET integrated database retrieval system