KEGG   Trypanosoma brucei: Tb10.61.0210Help
Entry
Tb10.61.0210      CDS       T01013                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  
translation initiation factor 4E
Organism
tbr  Trypanosoma brucei
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Tb10.61.0210
Messenger RNA biogenesis [BR:tbr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Tb10.61.0210
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Tb10.61.0210
Translation factors [BR:tbr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Tb10.61.0210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 251 aa AA seqDB search
MQTLLRPRPGEPTLFGPPTNQCTQLWGVWEMWCVLPDGHEAATATPNVRGSGAKKGGMSK
TKVKKATWLDQVRSIGLFDSAEGFWGIITCTLNPSQLPPGFNYYLFRRNIAPMWEHEANR
RGGRWVMRFRVSQHDDSPATALDGAVAAAAEGQLPVDRAWEALCVAMIGEQLPGDETEIC
GAVVRRAERRRDWKLSLWTRTAADRCTQERIGFFVKDLLHLEDGSLQYFSHRELMQASEK
GNWDVPPLYQL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccttactgagaccccgccccggagagcccactctctttggcccacccaccaat
cagtgcactcagctatggggtgtctgggaaatgtggtgcgtgttgcctgatggccacgaa
gcagcaactgctacaccaaatgtgcgtggcagcggcgcgaagaagggtggtatgtccaag
acgaaagtgaagaaggcgacatggcttgaccaggtgcgaagcatcggtctattcgacagt
gctgaagggttctgggggattattacatgtacactcaatccttcgcagctaccgcccgga
tttaactactacctcttccggcggaatatcgcccctatgtgggagcacgaagccaaccgc
aggggtgggcgctgggtaatgcgtttccgcgtctctcaacacgatgacagccccgctacc
gctctcgacggcgctgtggctgccgcagctgagggtcaactcccagtggatcgagcatgg
gaggcgctttgtgttgcaatgattggtgagcagctcccaggcgatgaaacagagatttgt
ggagcagtggtgcggcgggcagagcgtcggcgagactggaagttaagcctctggacccga
accgccgcggaccgctgcacgcaggagcgcatcggcttttttgtgaaggacctgcttcat
ttggaagatggttcactacagtatttctcgcaccgcgaactaatgcaagcgagtgagaag
gggaactgggatgtcccacccttgtatcaattgtga

DBGET integrated database retrieval system