KEGG   Trypanosoma brucei: Tb10.61.0250Help
Entry
Tb10.61.0250      CDS       T01013                                 

Definition
mitogen-activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tbr  Trypanosoma brucei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 365 aa AA seqDB search
MDIPQELACPTEDRRLYVVRGQTFEVGRSHKLVKFIGSGSYGSVCSAVDEDSGERVAIKR
IQRVFSDLKEGKRILREMDILTSLHHTNLVRLRQFIRPVRKDDFSDIYIVMDLYDTDLHR
IIRSRQSLTNEHYQYLMIQAFRGLFYLHTAKVIHRDLKPSNLLVNADCTLAICDFGLARD
DQCTQTSALTEYVVTRWYRPPEVLGMGSHRYTNAVDVWSLGLIFAELMVGKTLLPGSDYI
HQLIMIVHLLGTPASEDMEFLSEEAKNFLLAQPFQEARPFTELFPAATPEAADLLSKLLV
FHPDKRLTAKEVIEHAYFAKFRNPAAETGAKEPYVWRHNEGLTLEGLREEMWRIILAHSP
GPKGD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggacataccacaagaactggcttgtcctacggaagatcgacgtttatacgttgtccgg
gggcaaacatttgaagttggccgttctcataaactcgtgaaatttattggatccgggtcg
tacgggtctgtgtgctcggctgttgatgaagatagcggcgaacgtgtcgctatcaaaaga
atacaacgcgtattctcagacttaaaggaaggcaagcgtatattgagggaaatggatatt
cttacatcgctacatcacaccaacctcgtacgcctaaggcagtttattcgcccagtacgg
aaagacgatttttctgatatatacatagtgatggacctttacgacacggatcttcaccgg
atcatccgaagtcgacaaagtcttacaaacgaacattatcagtacctaatgattcaggcg
tttcgtgggcttttctacttgcacaccgcaaaagttatacaccgtgacttaaaaccaagt
aatttattagttaacgctgattgtactctggctatctgtgacttcgggcttgctcgtgat
gatcaatgtacgcagacctctgcgctcaccgaatatgttgtaactaggtggtatcgacca
cctgaagtgttaggcatgggatcccatcgatatacaaacgcagtggatgtctggagccta
gggctcatctttgctgaattgatggttggtaagacgcttttgccgggctctgattacatt
caccaattgataatgattgtccatctcctagggacccccgcttcggaggatatggaattt
cttagcgaggaagcaaagaactttcttcttgcacagccttttcaggaggctcgaccgttt
acagaactctttcccgctgctactcctgaggcggctgatctactttcaaagctgctagta
ttccatcctgacaagcggcttacggcaaaggaggtgattgaacatgcgtattttgctaag
tttaggaaccctgcggcggagacaggtgctaaagagccgtatgtttggcgacacaatgag
ggactcacacttgagggccttcgtgaggaaatgtggcgtattattttggcacattctccc
ggtccaaagggtgactag

DBGET integrated database retrieval system