KEGG   Trypanosoma brucei: Tb10.61.0250Help
Entry
Tb10.61.0250      CDS       T01013                                 

Definition
(RefSeq) mitogen-activated protein kinase
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tbr  Trypanosoma brucei
Pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Tb10.61.0250
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Tb10.61.0250
Protein kinases [BR:tbr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Tb10.61.0250
Chromosome [BR:tbr03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     Tb10.61.0250
Exosome [BR:tbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tb10.61.0250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 365 aa AA seqDB search
MDIPQELACPTEDRRLYVVRGQTFEVGRSHKLVKFIGSGSYGSVCSAVDEDSGERVAIKR
IQRVFSDLKEGKRILREMDILTSLHHTNLVRLRQFIRPVRKDDFSDIYIVMDLYDTDLHR
IIRSRQSLTNEHYQYLMIQAFRGLFYLHTAKVIHRDLKPSNLLVNADCTLAICDFGLARD
DQCTQTSALTEYVVTRWYRPPEVLGMGSHRYTNAVDVWSLGLIFAELMVGKTLLPGSDYI
HQLIMIVHLLGTPASEDMEFLSEEAKNFLLAQPFQEARPFTELFPAATPEAADLLSKLLV
FHPDKRLTAKEVIEHAYFAKFRNPAAETGAKEPYVWRHNEGLTLEGLREEMWRIILAHSP
GPKGD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggacataccacaagaactggcttgtcctacggaagatcgacgtttatacgttgtccgg
gggcaaacatttgaagttggccgttctcataaactcgtgaaatttattggatccgggtcg
tacgggtctgtgtgctcggctgttgatgaagatagcggcgaacgtgtcgctatcaaaaga
atacaacgcgtattctcagacttaaaggaaggcaagcgtatattgagggaaatggatatt
cttacatcgctacatcacaccaacctcgtacgcctaaggcagtttattcgcccagtacgg
aaagacgatttttctgatatatacatagtgatggacctttacgacacggatcttcaccgg
atcatccgaagtcgacaaagtcttacaaacgaacattatcagtacctaatgattcaggcg
tttcgtgggcttttctacttgcacaccgcaaaagttatacaccgtgacttaaaaccaagt
aatttattagttaacgctgattgtactctggctatctgtgacttcgggcttgctcgtgat
gatcaatgtacgcagacctctgcgctcaccgaatatgttgtaactaggtggtatcgacca
cctgaagtgttaggcatgggatcccatcgatatacaaacgcagtggatgtctggagccta
gggctcatctttgctgaattgatggttggtaagacgcttttgccgggctctgattacatt
caccaattgataatgattgtccatctcctagggacccccgcttcggaggatatggaattt
cttagcgaggaagcaaagaactttcttcttgcacagccttttcaggaggctcgaccgttt
acagaactctttcccgctgctactcctgaggcggctgatctactttcaaagctgctagta
ttccatcctgacaagcggcttacggcaaaggaggtgattgaacatgcgtattttgctaag
tttaggaaccctgcggcggagacaggtgctaaagagccgtatgtttggcgacacaatgag
ggactcacacttgagggccttcgtgaggaaatgtggcgtattattttggcacattctccc
ggtccaaagggtgactag

DBGET integrated database retrieval system