KEGG   Trypanosoma brucei: Tb10.6k15.2060Help
Entry
Tb10.6k15.2060    CDS       T01013                                 

Definition
phosphatidylinositol 3 kinase
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tbr  Trypanosoma brucei
Brite
Protein kinases [BR:tbr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Tb10.6k15.2060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 2432 aa AA seqDB search
MEGCAHPLTSQLQPIFSELHSGKLATLSSTISKLENVLKDQGDGFFQSNSECQSREANLR
LSVWISSQIGQLFRRPETQRAAILCVKTLLDVEYEAINNLDQTFLRLLEDSVKCADMSVS
RMAAEVWGLWLNNSGTSTEGIAQSRLKICFADLRESDKVMDKVAACLFLEELLKRTPSTV
APLLDVVAECLHPAVLSSSDLVQASAATALRYVLLLMYTSMNPSGIKKWYETFLSASLDA
LRSGAPERRTGAIRCFNAVMSSVTSNVSACDTAVTFSETSVAHVHEIWEYVSEQVTLTST
LELRRELLQSLTILALYDTEAFKRMSIAKVVEAASGVFQTPTEKDLEPLVFQTLGKLAGV
MPDQIVTFLGCSMRHIEEVLKQGRHDACGLGAIACVAAFAEVNPRAVRPYLRQILAPILS
GSLTVDFAKGVARICAAFPELRSTCLSKILEVAKKQLRDDRCNAGGAGALCDGGVSPAAQ
ILSALSNLEFAGYPTLPFLCDTAVAYVSVPNGEVRRAAIKLCFKLVLSGCLGPQSPCRQT
SDGVVIHSGCEHTQLFNKVIKKLVNAAVADPESDIRLDTLRNFTEEFDHTLALRDVVRSL
FPALHDKHQNRLAVVRLLGRVSRRNPAHVYPMLRRIMVQCVTEMQYFEHAKKQEQAFSVL
GAIIESAPGLGKPYISSLLNMCAARLSDGTREADVCAALLSCVGKLVRYAEGDDIRVCAR
IRPIVVQHILDSSHLPKKREALRALGDIVRTTKDVNVYEDHAELLPVLLQALHGGFKELW
PVRKDVLQLMGIIGAVDPVRVKEILRGSRVNNNTKLVPFLPFEGEDTIAQTVVRSVLHIL
SLPSLTEDQSVAAVQVIVGIFSLEVLSPGCLVSFYGEVISSIQKQARVQVRKREEILVHL
ISLVRILKGHLRPHLKEITSTVDSFISATDLSVLRQVLALLKELCCSLREEFRPYMSSLL
GPIIVLVEENVEETSEIVLDFFSAMGSLLEDHLHTVLPVVCNIIVDTSVPSRCRIVAVKT
LICFTKRLPDLCFHASRCVHCLCRVLRESDGGDGVGDEGRLGFSAMEALCTLAGSLGKNF
ENFVLVVLPAVADRYGETSGEYCRFCHDIYEAIDGKRAPEVSSNGVGKAGGGGAPSLPFT
AGTSASPLKDRADAYASLRFHLRKRDQASDEDWNHWLPQLAVNLLRSSSSPSHGRALTLA
ELHEPFARQMLHSAFAACYADMDEHTQREVVGLLTEVLRGLRVPSEVMQELLNLSEHMER
QGIRLSAGGKASIKHSSNFCPFDRQVLMESSANCNLYSKALHYAEIEFFETVREYERSIL
RGCPKPLPVKDWQNLIKLCEKSIYFCNLLGQRESANGILKFIRQNLPLLTGKKVTELSQM
MDAHLFDKLRWWSQSLQAYERRLQQEPNKVSNMVGLLRALDALGEYPRVLEMWRQFSKRV
SKREVSKLASMGAHAAWLLRRWDDMEHITSFMSDEDYTGTTALFYKATLAARKKRFREAE
KLIDMCRKRVDSKLSALVAESYDRAYDLFVGIQQLSELEELAMATSDPQSAMHWRQLWER
RLSVMAYEGWPGTLANHTLLVPPSSEIDMWLRFVSLSRAHGQGSVSTEVLRELLGNQSIE
SAIENGIPTPAVAMGSFQHLYETNQRDSAIARLQLYVSKVEGSGAQHVSREREDMAVCHA
KLAEWLVHQKKAHRTEDELQKIFHHLRRATELDKSNGSIWRTLARVHREAATKPADGSDS
SGASGHIMEALSAYLRSVSLSEELEDALGFLSLWFMYGPLLAVQVGSTLKEEIEEVNPTV
WLKVIPQIIARISSPNGTVADSVYNLLVLVARRHPQAILYSLNVAHSSYQGKGTADGVEP
LKGSHRVLARIAEIHQNGKAMVEDSALVCRELVRCAVLWPELWINELGRALYQWERQRSA
ENLLLAMGPLLEQLKRPETMAEAQFAAELRQPLENACCHVERAVSSRHEQFMEEARRIFV
SIERRIREQISGMSSLALQLVSPKLHQNGRNLSLVVPGQYREDGNYPLIASFQNVLKVLN
SKQRPRRIYINGSNGEIYKFLLKGHEDLRLDERVMQLLGFVNTILEKHSVAKRHDCLIQT
YSVTPLSDNAGLVGWVDHCDTLNKIIEDYRVNPRCIRMELDLMRSMCDNLYYLTAIQRVE
PFEFALERTEGVDLVRSFWVKAPSAETWLERRTTYVCSLATMSMVGHILGLGDRHPSNLM
IHAFSGRVVHIDFGDCFEVAQQRSIHPEKVPFRLTRMLVKAMEMGGIEGLFRHGCHTVMN
VLREEGGSLLALLEAFVHDPLVSWWRDEAEGFSGNGQAASSVQTISVIGSMTNVAEEDSV
GSLQLSQLSVQRRATTQQRVNANIEKDTSQTRKPKSVVKRIKRKLRGLEFPQSQEGKGSD
GFTVEEQVSRLIEEATSNENLCVHFLGWCPFW
NT seq 7299 nt NT seq  +upstreamnt  +downstreamnt
atggagggctgcgcccatccgttaacaagccagctacagcccattttcagcgaattacat
tctgggaagttggcgacgctgtcatctactatttcgaagctggaaaacgttcttaaggac
caaggtgacggcttcttccaaagtaactccgaatgtcagtccagggaggccaacttgaga
ctttcggtttggattagctcccaaataggacagctttttaggagaccagagactcaacgt
gccgcgatattgtgtgtcaaaacgctcctagatgtggagtatgaggccatcaacaacttg
gaccagacgtttcttaggcttctggaagactctgtgaagtgtgctgacatgagcgtctcg
aggatggctgcagaggtgtggggactctggctgaacaatagtggcacttctaccgaagga
attgcacagtccagactgaaaatttgttttgccgatcttcgggaatcggacaaagtaatg
gataaggttgctgcgtgcctgtttcttgaggagctccttaagcgcaccccgtcgactgtt
gcaccgttgctcgacgtcgttgccgaatgtcttcatccggcagttcttagttcctcggat
ctcgttcaggcaagcgcggcaacagctctgcggtacgttctgttgcttatgtatacatcg
atgaatccgagtggaatcaaaaagtggtatgaaacatttttaagtgcttcgcttgatgct
ctgagatcaggtgcccctgagcgccgcactggtgccattcgttgcttcaacgctgttatg
tcatccgtcacgagcaatgtctctgcgtgcgacacggctgtgactttttcagaaacatcg
gttgctcacgttcatgagatatgggaatatgtcagtgagcaagtgacgctcaccagcacg
ctggagctgaggcgggagcttctacagtcgttaactatacttgcactgtatgacactgag
gcgtttaagaggatgtctattgcaaaagttgtggaagcggcttctggtgtcttccagacg
ccgacagaaaaagatttggagccgttagtgttccaaaccctgggaaagctcgcaggagtt
atgccagatcaaatagtcacatttcttggttgttcaatgcgtcatattgaagaggtactg
aaacaagggaggcatgatgcgtgcggtttgggggccattgcgtgtgttgctgcgttcgca
gaagtgaatcccagggcggtgcgaccgtacctgcggcagattcttgcacccattctttcc
gggtcgcttactgttgactttgcgaagggcgttgcccgcatttgtgcggcgtttcccgaa
ctgcggtccacatgcctgtcgaagatattggaggtagcaaagaaacaactgcgagacgac
cggtgtaacgcaggcggcgcgggtgctttgtgcgatggaggagtcagtcccgcagcacag
attctcagcgctctaagtaatctcgagtttgctgggtatcctactttgccctttctgtgt
gacacggccgttgcttacgtttcggtccctaacggagaggttcgacgtgccgcaataaag
ctttgctttaagcttgtgttatctggttgtctaggcccgcagtcgccttgtaggcaaact
tctgatggtgttgtcatacatagcggctgtgagcatactcaacttttcaacaaagtaatc
aaaaaactggtgaacgctgcggtagcagacccggagagtgacatcagacttgacactttg
agaaactttacggaggaatttgaccatacgcttgctctccgtgatgttgtgaggtctctg
tttcctgccttgcatgacaaacaccagaacagattggcggttgtccgtcttcttggtcgg
gtgtcgcgtaggaacccagcacatgtttatcctatgctaaggagaattatggtgcagtgt
gtgaccgaaatgcaatacttcgagcatgcgaagaagcaagagcaggccttttccgtgctg
ggtgccataattgaatctgcgcctggcttgggtaagccttatatatcgtccttgctcaac
atgtgtgcagcaagactgagcgatgggacgcgggaagcggacgtctgcgcagctttgctg
tcatgtgtggggaaactcgtccgttatgctgaaggtgacgacattcgcgtttgtgctcga
atacgacccatcgttgttcaacacatcttagattcgtcacatttaccgaagaaaagggag
gcgctacgtgctctcggtgatatcgttcgtacgacaaaggacgttaacgtttacgaggac
cacgcagaactccttcctgtgctccttcaagcattgcacggtggatttaaagaactgtgg
cctgtcaggaaagatgtgcttcagttaatggggataattggtgctgttgaccctgttcgg
gtaaaggaaatcctccgggggtctcgtgttaacaataatacgaaattggtacctttcctt
ccgtttgagggtgaagataccattgcccagacggttgtgcggagcgtcttgcatattctt
tctcttccgtcactaacagaggatcaaagtgtggctgctgtgcaggttatcgttggcatt
ttttcactggaggtgctttcccccggctgtcttgtttcgttctacggtgaggtgatttct
tccatccaaaagcaagctcgagtacaagtgcgcaaacgggaggaaattttggtgcacctc
atctcacttgttcgcattctgaagggacatcttcgccctcatcttaaggaaatcacatct
actgttgattccttcatttctgccaccgacctgtccgttctgaggcaggttttagcgttg
ctaaaggagctgtgctgctctcttcgtgaggagtttcgaccgtatatgtcgtctctcctc
ggtccaataatagtccttgtggaagaaaatgtggaggaaaccagtgaaattgtgcttgac
ttcttctcggctatgggttccctattggaggaccacctccataccgtcttgccggtcgtg
tgcaacatcattgtagatacttctgtgccatctaggtgtcggattgttgcggtgaaaaca
ctcatttgctttacgaagaggctacctgatctctgtttccacgcctcccgctgcgtgcac
tgtctgtgccgtgtgctaagggaatccgacggcggagatggggtgggcgatgaggggaga
ctggggttttccgcgatggaggccttgtgcacactcgcgggaagtttggggaagaacttc
gaaaactttgtcctggtcgttttaccggcggtagcagaccgctacggggagacaagcggg
gagtactgtcgcttttgccatgatatttatgaggccatcgatggaaagagggcccctgaa
gtttcatcgaacggcgtgggcaaagctggtggcggtggtgcaccttcgcttcctttcacc
gcagggacgagcgcatcaccgttaaaggatcgtgccgacgcatacgcttctctccggttt
cacctccggaagcgggaccaggctagtgacgaagattggaaccattggctaccgcagctt
gcagtgaacttgctgcgatcaagctcgtctccttcacatggccgtgctctgactcttgcc
gaactgcatgagccctttgcacgacagatgctgcactccgcttttgccgcttgctatgcc
gacatggatgaacatacacaacgtgaggtggttgggttactcactgaggttttgcgcggg
ctgcgggtacccagtgaggttatgcaagagctactcaacctgtcggagcatatggagcgt
caggggattcgtctaagcgccggcgggaaggcaagcataaagcattcctctaacttttgc
cctttcgaccgccaagttcttatggagagtagtgcaaattgcaatttgtactccaaggca
ctacattacgctgagatcgaattttttgagacggttcgcgagtacgagcggagtattctt
cgaggttgcccaaagcctcttcctgttaaggattggcagaatcttataaaactctgtgag
aaaagtatctacttctgtaaccttcttggacagcgagagagcgcaaatggcatacttaaa
ttcattcggcagaatctaccgttattaacagggaaaaaagtgacagagctgtcccaaatg
atggatgcgcacctctttgacaagctgcggtggtggtcgcaaagcctgcaggcatacgag
cggcgcttacagcaggaaccaaacaaggtttccaacatggttggtttactaagggcactc
gatgccttaggtgagtacccgcgcgtgttggaaatgtggaggcagttctctaagcgagtc
agcaaaagagaagtctccaaattggcgtcgatgggcgcccacgcggcttggctcctgaga
cgttgggacgatatggaacacatcacgagttttatgtctgacgaagactacacagggaca
accgctcttttctataaggctacgctagcagcgcgtaaaaaaaggttccgtgaggcggag
aagttgatcgacatgtgccgcaagcgcgtcgactccaagctgtccgctcttgttgcggag
agctacgatcgtgcatatgaccttttcgtcggcattcaacagttgagtgagctggaagag
cttgcgatggccactagtgatccacagagcgccatgcattggaggcaactgtgggagcgc
cgactgtccgtaatggcttacgaggggtggcccggcacgctagcgaatcatacccttttg
gtgcctccatcaagtgagatcgatatgtggttgcgttttgttagtttgagccgtgcacat
ggtcaagggagtgtctccactgaagttttacgcgagttacttggcaaccaatctatagag
tctgctatagaaaacggaataccgactcccgctgttgcaatgggatcatttcaacacctc
tatgaaacgaaccagagggactcagcgattgcaagactgcagctgtacgtgagcaaggtg
gagggctctggagcacagcacgtcagtagggaacgagaggatatggccgtttgtcacgcc
aaattggcggagtggttggttcatcaaaagaaggcacatcgtacggaggacgaattgcaa
aaaatttttcatcacctccgtcgcgccactgagttggacaaaagcaacggctcgatttgg
cgcacgttagcgcgtgtacaccgtgaggcggctaccaaacccgctgacggatccgactcc
tcgggtgcaagtggccacatcatggaggccctcagtgcctatttgcggagtgtgtccctc
tccgaggaactagaagatgcccttgggtttctttccctttggttcatgtatggacctctt
ctggctgtgcaggtgggctcgaccctcaaggaggaaattgaggaggttaacccgactgtg
tggctcaaagtgattccgcagatcatagcgcgtatatcttcacccaacggtaccgtagcg
gattctgtttataatcttctcgtgttggtcgcaagaaggcatccgcaagccattctctac
agcctgaacgtcgcccactcaagttatcaggggaagggtacggcagacggtgtggagccc
ttgaagggttctcatcgagtacttgctcgaattgcggagattcaccagaacggtaaggcg
atggtcgaagactccgcacttgtttgccgtgagttggttcgctgcgctgtgctctggccc
gagctgtggatcaacgaactagggagagctttataccagtgggaaagacaaagaagcgca
gagaatctcttgttggcgatgggaccgttactggaacagctcaagagacctgagacaatg
gcggaggcgcagtttgctgcggagctcaggcaaccactcgagaatgcatgctgccatgtt
gagagggctgtttcttctcgccatgaacaatttatggaggaggcacgacgtatttttgtt
tctatagagagaagaatacgtgaacagattagtggaatgtcatcgttggcattgcagttg
gtaagccctaaactgcaccaaaacgggagaaacttgtcattggttgtgccaggtcagtac
agggaggacggaaactatcccctgattgcttcctttcagaatgttctgaaggtgcttaac
tcaaaacagcggcctcggcgtatttacatcaacgggtcgaatggcgagatctacaagttc
ttgctgaagggtcatgaggatctacgtttggatgaaagggttatgcagttacttgggttt
gtcaacactattcttgagaagcattcggttgcaaagcgccatgactgccttatccagacg
tactcagtcacccctcttagcgataatgctggactggtaggttgggtggaccactgcgac
acactgaacaaaatcattgaggattatagagtgaatcccaggtgtattaggatggagctt
gaccttatgagaagtatgtgtgacaatctgtactatcttaccgccattcaacgtgtggag
ccgtttgagtttgcgttggagcgaactgagggagtggatctcgttcgctccttctgggtg
aaagctcccagcgcggagacgtggcttgagaggaggacgacatacgtttgctcactcgcc
accatgtctatggtggggcatatattaggactgggtgaccgtcacccttcaaaccttatg
atacacgcatttagcgggagagtggtgcacattgacttcggcgactgctttgaagtggcg
cagcagcgaagcattcaccctgaaaaggtaccgtttcgacttactcgtatgttggttaag
gcaatggaaatggggggaatagaaggtctctttcggcatgggtgtcacacagtgatgaat
gttttgcgtgaagagggtggtagtctcttagcattacttgaggcatttgttcacgacccc
ttggtgtcttggtggcgtgatgaggctgagggttttagtgggaacggccaagccgcttca
tcggtacaaacaatctcggttataggctccatgacgaacgttgctgaggaggacagcgtg
gggagtctgcagttgtcacagttgtcggtgcaacggcgagcaaccactcagcagcgcgtg
aatgccaacatcgaaaaggacactagtcagactcgcaaacctaaaagtgtcgtcaaacgt
attaaaaggaagttaaggggtctggagtttcctcaatcacaggagggtaagggcagcgat
ggttttacagtggaggaacaagtgtcgaggttgattgaagaagcaacttctaacgaaaac
ctttgcgttcacttcctcgggtggtgccctttctggtag

DBGET integrated database retrieval system