KEGG   Trypanosoma brucei: Tb10.6k15.2290Help
Entry
Tb10.6k15.2290    CDS       T01013                                 

Definition
protein disulfide isomerase (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tb10.6k15.2290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 497 aa AA seqDB search
MRAIFLVALALATMRESTAESLKLTKENFNETIAKSEIFLVKFYVDTCGYCQMLAPEWEK
AANETIDNALMGEVDCHSQPELAANFSIRGYPTIILFRNGKEAEHYGGARTKDDIIKYIK
ANVGPAVTPASNAEEVTRAKEEHDVVCVGLTASNSTSLSTTLAEAAQSFRVSLKFFEAEP
KLFPDEKPETIVVYRKGGEKEVYDGPMEVEKLTEFLQISRVAFGGEITPENYQYYSVIKR
PVGWAMVKPNETASIELKESLTEVGKKMRSHMVVLWVNISKHPVWRDFGVPEDAKYPAFL
AIHWGANYLHSTAEVVTRESLEKFILEFAAGRVEPTIKSLPVPEVETVDGKTTIVAKTMQ
KHLTSGKDMLILFFAPWCGHCKNFAPTFDKIAKEFDATDLIVAELDATANYVNSSTFTVT
AFPTVFFVPNGGKPVVFEGERSFENVYEFVRKHVTTFKVSEKPANVTEEKKSEEENKSSR
SNESNDSNESNVDKQDL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctatttttcttgttgctcttgcgctcgccaccatgcgcgagtcgactgcggaa
tccctgaagctcaccaaagagaacttcaacgagaccatcgcaaagagtgaaatatttctc
gtgaagttttatgttgacacctgtggatactgccagatgctcgcaccagagtgggagaag
gcggccaatgaaactattgacaatgcacttatgggcgaagtcgactgtcactcacaacct
gaattggcggctaacttttccatcaggggatacccaacaatcattctctttcgtaatggc
aaggaggcggagcactacggtggtgcccgcacgaaggacgatattatcaagtacattaaa
gcgaacgttggaccggcagtgacgccagcgtccaatgctgaagaggtgacaagggcaaag
gaggagcatgatgtagtgtgcgttggcctgacagccagcaatagcacttcactttctacc
acactggccgaggccgcgcagtcgttcagagtcagcctcaaattctttgaagcagaacct
aagcttttccccgacgagaagcccgagaccattgtggtgtacaggaagggaggcgaaaag
gaggtttacgatggccccatggaagtagagaagttgacagaattccttcaaatttctcgc
gttgcctttgggggtgaaattaccccggagaactatcaatactactcagttataaaacga
cccgtaggatgggctatggtcaagcctaatgaaactgcttcgatcgagttgaaagaaagc
ctcacagaagtgggtaaaaaaatgcgatcccatatggtagttctctgggttaacatttcg
aaacatccggtttggagggacttcggtgtcccggaggacgccaagtaccccgcctttttg
gctatccactggggcgccaattacttgcattccacagcggaggttgtgacccgcgagtcc
cttgagaagttcatcctggagtttgctgcaggtcgtgtcgagcccaccatcaagtccctc
cctgtccccgaggtggagactgttgatggcaaaaccaccatcgtggcaaaaacaatgcag
aagcaccttacgtcgggaaaagacatgctcatccttttctttgccccttggtgcggtcac
tgcaagaatttcgctccaacctttgataagatcgcgaaggagttcgatgcaaccgacctt
atcgttgccgagcttgatgccacagccaattacgttaactcgtctacttttacagttaca
gcatttccgacggtgttcttcgtcccgaatggagggaaacccgttgttttcgaaggtgaa
cgctcatttgaaaacgtctacgaatttgttcgcaaacatgtgacaacgtttaaggtgagt
gagaaaccagctaatgtgacagaggagaagaaaagcgaggaagagaacaagagcagtagg
agcaatgaaagtaatgatagcaatgagagcaatgttgataaacaagatctgtag

DBGET integrated database retrieval system