KEGG   Trypanosoma brucei: Tb10.6k15.2720Help
Entry
Tb10.6k15.2720    CDS       T01013                                 

Definition
protein-L-isoaspartate
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tbr  Trypanosoma brucei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 241 aa AA seqDB search
MAWTCSGVTNAGMIQRLEAASLLVTPAVIEAFRRVDRGWFLPHSPPEVAYSDQPVPIGYG
ATISAPHMHAIMVEIIAPFLLRTPEGVKPATVLDVGSGSGYLTAVLAELCSGRGGTVIGV
EHISELVVRSTEVVNKHFRSWVEEGRIKFIEGDGRNITGLLGQKVPDFDVIHVGAAAATV
PQVYIDALKPGGCLVIPVGREGEAQTLRVYTKDMDGHISSTNHGGVRFVPLTSAKHQRGG
I
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcatggacatgttccggtgtaaccaatgccggtatgattcaacgtttagaagcggct
tcgctgttagtcacgcctgccgttatcgaggcctttcgtcgtgttgatcgcggctggttt
ttgccgcattcgccacccgaagtggcatacagcgaccagcccgttcccattggatacggc
gcaaccatcagtgcaccccacatgcacgccattatggtggagatcatcgctccatttctc
ctccgaaccccagagggcgtaaagccagccacggtgttggacgttggtagcggaagcgga
tacctcacagccgtccttgcggaactttgcagtggtaggggaggaactgtaatcggagta
gaacacatctcggaactggtggttcgatcaacagaagtggtgaataagcattttcggtcg
tgggtggaggaagggcgaattaagttcattgaaggagatggtaggaatataaccggactt
ctcgggcagaaagtgcctgactttgatgttattcatgttggagctgctgcggcaacagtg
ccgcaggtttatattgatgcattaaagccaggcggatgcctcgttattcctgttggaaga
gagggcgaggcacaaactttgcgcgtttacacgaaggatatggacggtcacatctcctcc
actaaccacggtggagtacgatttgtcccactgacatcagcgaagcaccaaaggggaggt
atttag

DBGET integrated database retrieval system