KEGG   Trypanosoma brucei: Tb10.6k15.3080Help
Entry
Tb10.6k15.3080    CDS       T01013                                 

Definition
dihydrolipoamide acetyltransferase precursor (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tbr  Trypanosoma brucei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:tbr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tbr00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tbr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tbr00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 451 aa AA seqDB search
MFRRPVAQHIFPVCFARFLTVTPIPMPALSPTMEKGKISEWVKKVGDAVETGDTWCKVET
DKAVVSYDNVSEDGFVARILVQVGEEATVGDAVCLIVDEASGVNSDEVKNWQAAGSSPAA
TQSKVQEVPSPTQVAPLPAGGKEAGGRVKASPLARKTAAELNVSLDTIEGTGGGVGRIVR
KDVEAAASKREHAAPAAAPAAKPVVPVIATTPSTQNYTDIPVTNMRSTIAKRLTQSKNVE
IPHYYLFEECCAENMMALVQQLNSKGDGKYKITLNDYIIKAVARANMLVPEANSSWQGDF
IRQYRTVDVSVAVATPTGLITPIIKDAQARGLVDISNEMKVLAKKAREGTLQPHEFIGGT
VSVSNLGASGIPGFTAIINPPQALIVAVGSAKPRPRMSLDPDTGKYTVGAEAEMFVRFTA
SFDHRVVDGAVASQWCKHFKDAVENPLSLLL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttccgccgtcccgtcgcgcaacacatctttcctgtgtgctttgctcgttttctgaca
gttacgccgatccctatgccagctctctctccaaccatggagaagggaaaaatatctgaa
tgggtcaagaaggttggagacgcagttgaaacgggcgatacatggtgcaaggttgaaaca
gacaaagccgttgtttcgtacgacaatgtgtcagaggacggctttgtcgcccgtattctt
gttcaagttggggaagaggccacagtcggcgatgcggtgtgccttattgtggatgaggcg
tcaggtgttaactcagatgaggttaagaactggcaggccgctggcagttcccctgcggca
actcagtcaaaggtgcaggaggttccctcacccacacaagtggcgccactaccagccggc
ggaaaggaggctggtggtcgtgtgaaggcgtctcccctggcccgaaagacggcggcggag
ctcaatgtatcactcgacaccatcgagggcactgggggaggggtgggccgaatcgtgagg
aaggacgttgaagctgcagcgtcaaagcgtgaacacgctgctcccgccgccgcgcctgcc
gctaagcccgtcgtgccagtaatagccacgactccatcaacccagaactacaccgacatc
cccgtcacgaacatgcggtcaacgatcgccaaacgccttacacaatcaaagaacgtggag
attccgcattactaccttttcgaggagtgctgcgcagagaatatgatggccctggtacag
caactcaactccaagggtgacggcaagtataaaatcacgcttaatgattatatcatcaaa
gcagtggcgcgggcgaatatgctggttcccgaggctaacagctcgtggcaaggggacttt
atccgtcagtatcgcaccgttgacgtgagcgttgcagtcgcaactcccacagggctcatc
acccccataattaaggatgcacaggcacgtgggttggtcgacatttcgaacgagatgaag
gtccttgcaaaaaaagcccgcgaggggacacttcagccacacgagttcattggtggaaca
gtgtctgtgtccaacctcggagccagcggtatccccggtttcacagctattataaatccc
ccgcaggcgctcatcgtagctgttggctccgccaaaccccgtccgcgtatgtctttagat
ccggacacaggaaagtacacagttggcgcggaagctgagatgtttgtaaggtttaccgca
tcatttgaccaccgcgtggttgatggtgccgttgcgtctcagtggtgcaaacacttcaag
gatgcggttgagaacccactctcgctattgctgtag

DBGET integrated database retrieval system