KEGG   Trypanosoma brucei: Tb10.6k15.3960Help
Entry
Tb10.6k15.3960    CDS       T01013                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tbr  Trypanosoma brucei
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tbr00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 264 aa AA seqDB search
MLPPPHPREDEDLTRQRHSPAHIIVFVGPSGCGKSTLADEIMKRWPNRFAFSVSHTTRKP
RKNEVNGKHYHFVSKEKFLQLLADGLFAEHSKSFTKAKRNTSDDCGPRGSGAEEDDEDTV
YYGTSKMALHDVLSNGRIVLMDTDISGAIKIKRYCDEINTQLTGKTEQSVVQSNAGVIRR
LQLHLIFVKCPNLEVGEQRLRNRGTETLTSLQRRFLSNRQCIQWYNAHTGFFNLTLVNDT
LERCLEDLFSYVSGKILCSPSSKL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttgccccctccccacccgagggaagatgaagatttgactcgacaaagacattctcca
gcgcatatcatcgtttttgtgggtccaagtggctgcggaaagtcaacactagcagatgag
attatgaaaaggtggccgaaccggttcgcctttagtgtcagtcacacaactcgcaagccg
cgtaagaacgaagtgaatgggaaacactaccactttgtttctaaggaaaagtttcttcaa
ctgcttgccgacggtttgtttgccgagcacagtaaaagcttcacaaaagcgaagcgaaac
acaagtgacgattgcgggccgcggggttctggcgctgaggaggacgacgaagacacagtc
tactacgggacctcaaagatggcgctccacgatgttctttccaacggacgaattgttctg
atggatacagacatcagtggggctattaagataaagagatactgcgatgagattaacaca
caacttacgggcaagactgagcaatccgtcgtgcagtcgaatgcgggtgttatacgacgg
ttgcagttgcaccttatctttgttaaatgcccaaacctggaggtgggggagcaacggttg
cgcaaccggggaacggagactttgacgtcgcttcaacgtcgcttcctgtcaaataggcag
tgtattcagtggtacaatgcacacaccggtttctttaacctcacgttggttaatgataca
ctggaacgatgtctagaagatcttttttcctacgtgagtggaaagatactttgctcaccg
agcagtaagttgtga

DBGET integrated database retrieval system