KEGG   Trypanosoma brucei: Tb10.70.0830Help
Entry
Tb10.70.0830      CDS       T01013                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
tbr  Trypanosoma brucei
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:tbr04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 1703 aa AA seqDB search
MDNPLTSAEVFQLNSVSGGLRPGTISFKTLTLQSDKYVCIRDVQPDGQTSLVIVDLGKRE
SMRNSIRDAESAIMNPMAKILALRSGRNLQIFDVDAANRLKVVVFNEDVVYWCWIDARTV
GIVSNTAVYHWSLDTAADAPPQLVFSRAPEFDASFQVLSYQTDEQKKWLMLCGVMRTAEG
MVGKTQLFSVENNSGRVLDGHSGTFISTNTPTDPRSCNLMCLAWNNPSTGGKILIMELPT
GSKTDLTVQRRMIDVPFAQGDFPVATHVSPRHKLLTVVTSRGSVVLMDLFTGVVIKTHQL
PNNTIFCGTPYTKTGGILCVNNAGSVFHVSPNDNTIVPFVKNQLQNADLALRIAGSANLG
GVDDLYRVQLDNQLRAGNIEEAVRTCLRAPNNALRGPDILSRFQLMPPIPGQQPAISTYF
KVAVAETTLNAHESAELARAVIPKGGVDYVKQQYAADKLTASEELGDLMSAADPELAIKI
YHKAEAHAKVVGVLLQRNETQKAVEYCKRAGFTPNWRVILNNAIHVNPQGAVGLAQVLHR
DMGDAPVVDPIEVVDMFVTAQHIQQATEFVLEVLRDNTGENTKDLQTKLLEINLKHSHPS
VAEKIFARGVCVHFDAMLLAPLCERASLPQRAIECYVMAQRMDPGIDNLANIRRCFSNAQ
VLSPDWVIEFFGKLSPGDSMKCLEDLLANHHQNFKIIVQVATKYNEALGADKLINVFLER
KLFDILYYYLGAVVPYTRDPEVHFRYIEAAAEVGQVQELERMTRESPCYDPERTKNYLKN
KKMTNLWPLINVCDQHNFVDELIRYLIDTNNEALIEQYVQRRNPLKTPAVVGALIDCNVQ
EDFIKNILNSVGTMCPIAELVDVAEERSRLRLIGPWLEARLAEKKTDTALHNAIAKLLVI
SGNLPEKFIEENDYYDPVVMGKYCEDRDPNLSYLVYRKAKMSTELVEITSKNGMWKQLAR
YLVKQQDPALWASVLTESSINRDRLVEAVQQTALPESEVTEEVSTTVKAFMDAELTEELT
SILDQIVVRGRFRKNRYLENLLIMSAVRASKAKVMEYVTTLDSYDAKEIAGIATAAELHE
EAMTVYDKFEMRMEAATVLLRDLKDLPRGRLYAQRCNLPAVWTVLGEYLLAAGEVREAIE
VLIRAKNPNYVDAVTAAAERSNQFGDLVKYLNMARQESTSNDNKIESVLLLTYARTGRLS
ELEELLQNTHNVQIQPVADKCFEDGYYDSARLLYSMSMNFHKLALTLVRMNNLAEAVDAA
QKAQSRSTWDAVNHACIEANDVRLAAICAVPLVLQVESLQDVVNRYEAYGLYDELFAVLK
SASTNSGAHMGIFTEMGLQLAKYKPEKLLEHVHMYSKKINAHKLISVCEEYHHWLALRVL
HVGNEDWLAAAKTMMCHFADAFDHDVFKDVASHLGASDFVYNAISFYVNTCPQNLCDFLT
SMFKVLDPDRVLREVKNVAPIHLILPYLESAQPRNSRLINDALNDLYVEEENFVALRNSV
ENYNNFDSVELSARLEKMELFEFRKIALFLHRRHKAFDHALAVAKENKLFQEAIDTAVES
ADPKVVEELLDFFAVERPDSFVSCLYACYDYLSPDVVLEKAWLNNRINIAMPYLIQAIHD
FTQRVSRLEKGANDGMQPSKDGSRRGGVPGYAGGNDPLMIQAGPAQPMGVPMHNVNIHPQ
PGYGGVPGQGYAGGMGNPNMMPY
NT seq 5112 nt NT seq  +upstreamnt  +downstreamnt
atggataatccactaacctctgcggaggtctttcaactcaactccgtctctggtgggttg
agaccgggaaccatttccttcaagacactgacgctgcagagcgacaagtacgtttgcatc
cgcgatgtgcaacctgatggtcaaacctctcttgttatcgtggatctcgggaagcgggag
agcatgcgcaacagtatacgtgatgcggagtcagccatcatgaatcctatggcaaagatt
cttgcactccgcagcggccgcaacttgcagatattcgacgtggacgcggctaatcgtctc
aaggtggttgtgttcaacgaggacgtggtctattggtgttggattgatgctcgcactgta
ggtatcgtctctaataccgcagtgtatcactggagtctggacacagctgccgatgctcca
ccgcagttggtcttctcgcgggcccctgagtttgacgcctcgtttcaggttcttagttac
cagacagatgagcagaagaagtggttgatgctttgtggtgttatgcgaactgccgagggt
atggtggggaaaacacaactcttcagcgtcgaaaacaatagtggccgtgtgcttgacggt
cacagtggaacattcatttccaccaacaccccgacagacccacgctcatgcaatttgatg
tgcctcgcttggaacaacccctccacaggtgggaaaattttgatcatggagcttcctaca
ggatccaaaacggatctcacagttcagcgccgtatgatcgatgtcccctttgctcagggt
gactttcccgttgcgacacacgtctcaccacgacacaaactcctcaccgttgtgacaagc
cgtggtagcgtggtgcttatggacctcttcactggagtggtcattaagactcaccaactt
ccgaacaataccattttctgcgggacaccctacacgaagactggtggtatcctgtgcgtg
aacaacgcgggctccgtgttccacgtgtctccaaacgacaatacgatcgttccctttgtg
aaaaaccaattgcaaaatgctgatctggcccttcgcattgccggctctgctaacctggga
ggtgtggatgacctgtacagggttcagctggataaccagcttcgtgctgggaacatagag
gaggcggtgcgcacatgcctacgtgcaccaaacaacgccttgcgtggtcccgatattctt
tctcgcttccaacttatgccgccgattccggggcagcagcccgcaatctccacctacttt
aaggtggcagttgccgaaaccactcttaacgcgcatgagtcagcagaacttgcccgtgcc
gttataccgaagggtggtgtcgactacgtgaagcaacagtatgctgctgacaaactaacc
gcctccgaggaacttggtgatcttatgtcagcggcggacccagagcttgccatcaaaatc
taccacaaggcggaggcacacgcaaaggttgttggtgtcctccttcaacgcaacgagaca
cagaaggctgttgagtactgcaaacgcgctgggttcacccccaactggcgcgtcatcttg
aacaacgcaatacacgtcaacccgcaaggtgccgtgggcctcgcgcaagtattgcaccgt
gacatgggtgacgcgcctgtcgttgaccccatcgaagttgtggatatgttcgtgaccgct
cagcacatccagcaagcaaccgagttcgttctggaagtccttcgtgataacactggagag
aatacaaaggatctccaaacgaagcttctagagattaacctgaagcattcccatccgtcg
gttgcggagaagatctttgctcgcggtgtgtgtgttcactttgatgccatgttgctggcg
cccctctgtgaacgcgcttcccttccgcagcgcgctattgagtgctatgtaatggcccag
aggatggacccgggcattgacaaccttgctaacattcgtcgttgcttttctaatgcccaa
gtgctcagccctgattgggttatcgagttcttcggcaaactgagcccaggagacagcatg
aagtgcctagaggaccttcttgctaaccatcaccagaacttcaaaatcattgtgcaggtt
gcaacaaagtacaatgaagcgctcggtgcggacaaactaattaacgtgttcctcgagcgg
aaactgtttgatattctgtattattaccttggcgctgtggtaccgtacactcgtgatcca
gaggtgcacttccgctatattgaggcagcggctgaagttgggcaggtgcaggaactcgag
cgcatgacacgtgagagcccgtgttatgaccctgagcgcacgaagaactacctgaagaac
aagaaaatgacaaacctttggccccttatcaacgtctgtgaccagcacaattttgttgat
gaactgattcgttatctgattgacacaaacaatgaagctcttattgagcagtacgtgcag
cgccgcaacccgctgaaaacacccgcggtagtcggtgcgcttattgactgtaacgtgcaa
gaggacttcattaagaacatcctaaactcagtgggtacaatgtgcccgattgcagaactt
gtcgatgtcgctgaagagcgcagtcggcttcgcctcattggaccctggttggaagcccga
cttgcggaaaaaaagacggataccgcccttcataatgctattgcaaaactcttggtcatc
agtggtaacttacccgagaagttcattgaggagaacgactactacgatccagtggtcatg
ggtaagtactgcgaggatcgcgaccccaacctgtcctatttggtttatcgcaaggctaag
atgagcaccgaactggttgagatcacatcgaagaatggcatgtggaagcaacttgctcgc
taccttgtaaaacaacaggaccctgcactttgggcgtctgtgctcacggaaagctcgatc
aaccgagaccgcctcgttgaggcggttcaacaaactgcacttcccgagtctgaggtaacg
gaggaggtgagcaccactgtgaaggcgtttatggatgcggagctgacggaggaactgacc
tctatactagatcagatcgtcgtccgtggccgctttaggaaaaaccgctatttggagaat
ctccttattatgtccgctgtccgcgcatccaaggcaaaggttatggagtatgtaaccact
cttgacagctacgatgcgaaggaaatcgctggcatcgctaccgcagcagagctgcacgag
gaagcgatgaccgtttatgacaagtttgaaatgaggatggaggctgccaccgttttactc
cgcgatttgaaggaccttcctcgtggtcggttgtacgctcagaggtgcaacctacctgct
gtatggacagttttgggagaatacctcctcgccgccggtgaggtgcgtgaagccattgag
gtcctcattcgcgcgaagaatcccaactacgttgatgctgtcactgctgcagcggagcgc
agtaaccaattcggggacctcgtcaagtatctcaacatggcacgccaggagtccacttcg
aacgacaataagattgagtcggttttgttgctaacgtacgccagaactggacgcctgtca
gaattggaagagttgctgcaaaacacgcacaatgtacagattcaacctgtggctgacaag
tgctttgaagatgggtactatgattcagcgcgtctgctctactccatgagcatgaacttc
cataaattggcccttacgcttgtgcgcatgaacaaccttgctgaggctgtggacgctgcg
cagaaggcccagtcccgcagcacatgggatgcggttaaccatgcctgtattgaggccaac
gatgtaaggcttgctgctatttgcgcggttcccctcgttctacaggtggaatctctgcaa
gatgtcgtgaaccggtacgaggcatacggtctttatgatgaactgttcgctgttctcaag
agtgcctcaactaactctggcgcgcacatgggcattttcactgaaatgggactacagctt
gccaagtataaacccgagaaactcttggagcacgtgcacatgtactcaaagaagattaac
gcacacaagttgatctccgtttgcgaggaataccaccactggttggccctgcgtgtgctc
cacgtcggcaacgaggactggttggctgcggcgaagacgatgatgtgtcattttgctgat
gccttcgatcatgatgtgttcaaggacgttgcaagccatctgggtgctagcgattttgta
tataacgcgatttcgttctacgtcaatacgtgccctcaaaacctgtgcgactttctgacg
agcatgttcaaggtgcttgaccccgaccgtgtgctccgtgaggtgaaaaatgttgccccg
attcacctgattctgccatacctcgaatccgcacaaccgcgcaactcccggttgatcaac
gatgctctgaacgatctgtacgtggaggaagaaaattttgtggccttacgtaactctgta
gagaactacaacaacttcgactctgtggagttgagcgcacggctggagaagatggagttg
tttgagttccgcaagattgctctcttcctccaccgccgtcacaaggcctttgaccacgcc
cttgcggtggccaaggagaataagctcttccaggaggccattgacacggctgtcgaaagc
gccgatccaaaggttgtggaggagcttcttgacttctttgcagttgaacgaccagattca
ttcgtttcctgcctttacgcctgctatgactacttgtctccggacgtggttcttgagaag
gcttggctaaacaaccgtatcaatattgccatgccgtacctcattcaggccatccacgac
ttcactcagcgggtatcacgcttggaaaagggcgctaacgacggcatgcagccatcaaaa
gatggatctcgtcgtggtggtgttcctgggtatgcgggtggtaatgacccactgatgatt
caggcaggcccagcacagcccatgggagttccgatgcataatgtgaacatccacccgcaa
ccgggctacggtggcgtgcccggtcagggatatgctggagggatgggaaaccctaacatg
atgccatactga

DBGET integrated database retrieval system