KEGG   Trypanosoma brucei: Tb10.70.1900Help
Entry
Tb10.70.1900      CDS       T01013                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tbr  Trypanosoma brucei
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:tbr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:tbr03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 500 aa AA seqDB search
MNPSYLNQILSYPQRESLISECPALALLCYQELVAAFRKGKRIADPLSLRDDVTVLLSIG
SLHELTDRIFSAAPHESALPPLWCTLRKALECAWDPRGDGERQCELTMVGGKLRFYKKKC
DRMPLAQSSMRNALNMSRTRIREVIACALSGSLEPLGGRRNEPIAALLQFSRLIPPPSEE
RVVTSEGLAFCMQPLQQQWWTLVSVVLDRALAIMSGKGVSRATLWQLLAVLFALNTSDYV
YLFPSKDDDLEAFQLLARLSEVGLVYPLICNGEKCFVLSPHFHHAICWSSTPSLCTAALL
DDTRGPSSRLRREDEDTIITETNFRLYAYTKNPDMLRILDQFAVKEVDVVGMVVCYRVTR
ASFASALAKGIGANHILQFLTVKAHPSMIKQSNSEAGDPSCPVLPAASVGFGNTSEYRQG
NIIPQSFCDQLFTWERECRRLIFRHDVVLLKNIGKEQMEIILNCLSNSGEQHAVVHRESG
TLAIEQEVYTRVLSNFITPD
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtcctatttgaatcagatattgagttacccccaacgcgaatcgctaatttcg
gagtgccccgcgcttgcactcctctgctatcaggaattagtggctgccttccgcaaaggg
aaacgcattgctgatccgctgtctttgagggatgatgtcacagtcctactttccattgga
tcgttgcatgaactgacggaccggattttctcagctgcaccgcatgaatccgctttgcct
cctctctggtgtacgcttcggaaggctcttgagtgtgcctgggaccccagaggtgatggt
gagcgacaatgtgaactaacgatggtgggtgggaaactccgattttacaagaaaaaatgt
gataggatgccgcttgcacagtcatcaatgcggaacgcacttaatatgagtagaacacgc
attcgagaagttattgcctgtgccctatcgggttcactggagccccttggagggagacgt
aacgagcctatcgctgcattacttcagttttcccgcctgatcccaccaccgtcggaagag
cgggtcgtcacctctgaaggattggcattttgcatgcagccccttcaacaacagtggtgg
acattagtatctgttgtgttagatcgcgcactggccataatgtcgggtaaaggagtctca
cgcgccactctttggcagcttctagctgttctgtttgcacttaacacaagtgattatgtt
tacttgtttccttcaaaggatgatgaccttgaggcctttcaactgctggcgcgcctctcg
gaggtcgggttggtttacccccttatttgtaacggagagaaatgctttgtgctttctccc
cacttccaccacgccatatgttggagttctacaccatcgctttgcacagcggcattgctg
gacgacacgaggggtccatcgtctcgtctacggcgggaggatgaagatactatcatcact
gaaacaaattttcgactatacgcatacacgaaaaatcctgacatgctgcgcattcttgat
caatttgcggtaaaggaagtggatgtggtgggaatggttgtatgctacagggtgacacga
gcatcatttgcaagtgcactagcgaaaggcataggcgcaaaccatatattgcaatttctt
acggtgaaggcacatccttctatgatcaagcagagcaatagtgaggctggtgacccgtcg
tgcccggttctccccgctgcttctgtgggattcggtaatacatctgaatatcgtcaggga
aatattataccacaatccttttgtgatcaactgttcacgtgggagagggaatgccgaaga
ctaatttttcgtcacgatgtggtgctgttgaaaaatatcgggaaagagcagatggaaata
atcttaaactgtctttcaaatagtggggaacagcacgccgtggtgcatcgcgagagcggt
actttggccattgaacaggaggtttacacgcgtgtactgtccaatttcattactccggat
taa

DBGET integrated database retrieval system