KEGG   Trypanosoma brucei: Tb10.70.2070Help
Entry
Tb10.70.2070      CDS       T01013                                 

Definition
protein kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Tb10.70.2070
Protein kinases [BR:tbr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Tb10.70.2070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 442 aa AA seqDB search
MSSEIEPHILRKYEIQAQLGQGAYGIVWRAIDRRTRQVVALKKIYDAFQNATDAQRTFRE
IMFLQALSHPNIIKLLHVHRATNDKDIYLVFEYMETDLHVVIRANILEDIHKQFIIYQLL
KTMKYLHSAELLHRDMKPSNLLVNSDCSMKVADFGLARSILSLEKEQVARPVLTDYIMTR
WYRPPEVLLGSTRYTKGVDMWAIGCILAELLLGRPIFPGRTTMKQLELIINVLGEPTAEE
IRSTNSQFAEAMLKDTRRTQTTTFAELLPKAPPDALDLVQKLMRFNPNERLTAEQALEHP
YVAAFHKPQDEPSAPAPITISLPDDTRFTMQEYRERLYQEIANARRKVRREVLGSGAPTR
GTHSSLATGTASGTSEEKKENARVSSAATRPASSSAARTTATAGSSSGAGLHRTTVASRS
AQHHTRPAVHRQPSGASRVLHK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagaaatagagccacatatcctccggaaatatgagatacaagcacagttaggg
cagggggcgtatggcatcgtctggcgcgcaattgaccggcggacgcggcaggttgtagcg
ttaaagaagatatacgacgcttttcaaaacgcaactgacgcgcagcgaaccttccgtgaa
ataatgtttctccaggctcttagtcacccaaacataattaaattgcttcatgtgcatcgc
gcaacgaatgacaaggatatttaccttgtattcgagtacatggagacggatttgcacgtc
gtaattcgtgccaacatcctggaggatatccataagcaattcataatttatcagcttctg
aagacaatgaaataccttcactcggcggaactgctgcatcgcgacatgaaaccgtcaaac
ctgcttgtaaacagcgattgctcaatgaaagtggcagattttgggctagcacgctccatt
ctatcgcttgaaaaggagcaagtggcgcgtcccgtactcactgattacatcatgacacgt
tggtatcggccacctgaggttcttctcggctccactcgctacacgaagggtgttgacatg
tgggccatcggatgcattctcgccgagttacttctgggacgacccatattcccaggccgc
accacaatgaaacagctagaactaattatcaatgttctaggtgaacccacagcggaggag
attcggtcgacgaactcccagtttgccgaagctatgctgaaggacacgcgtcgtacgcaa
accacgacgttcgcggaactgcttcccaaggcccctcctgatgccctggacctcgtacag
aagctcatgcgctttaacccaaatgaacgactaaccgctgagcaggcgcttgaacacccg
tatgtggcggctttccacaaaccccaagatgagccatctgctcccgcacccataactatt
tccctcccagacgatacccgcttcaccatgcaagagtatcgtgagcggctataccaagaa
attgctaatgcacggcgcaaagtccgacgagaggtattgggctccggcgcgcctactcgt
ggaacgcattcctcattggccacaggaacggcttctggaacctcagaggaaaaaaaggaa
aatgcacgtgtgtcgtcggcggccacacgaccggcgtcatcatcagctgcccgtaccacc
gccaccgcgggctcatcttcgggtgccgggttgcaccgcacgaccgttgcgtcacgatca
gcgcagcaccacacgcgaccggcagtacaccgacagccctctggagcctctcgtgtgttg
cacaaatga

DBGET integrated database retrieval system