KEGG   Trypanosoma brucei: Tb10.70.5540Help
Entry
Tb10.70.5540      CDS       T01013                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
tbr  Trypanosoma brucei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 662 aa AA seqDB search
MGGSYSTVKTQRELRNADLKVSPKSPNSFGRGDVRPTPSKALPSAARGTLPTRVAQVKVQ
REQGQDEGASRAQESSFQALPHLPTSRSQSFSNVAQKCGPLSGTPNTPSTSLYRSNILSP
SSTTVNGGVFGSPSTTAIPTRSSPSQTQYLEISGYPVGLENYGNTCYFNAVLQLLYHCSP
LRMRMLELNAIYEKKKGSSRFDSSTILALTADLFAKMHKVNNNKKRQKGVPTPRGLLNRV
RQLNSMFNNNHQHDAHEFAMFLLNELVETESHLMSDERNRTLFMRDEGKESKTSQWFSSL
WSRRQKETKKGAERSQSDVKEANESCTTVDCLELPRIFSEGEVCAMKLPSLTRLKSSDFS
DGVGGTSLYSTSGWDWGAPPSLEKILTGQFVSLTGCCECENVSVTREAFIDIGLNVVQGS
SLRRCVEELSVTEVFDGENKMNCERCGKKVAARRAMWINRLPEYALLVHLKRFHYDEKTG
KMRKRSEHIALPREIDVVEYEPCGEKCNEAAGDGSFCCEEDTSGPEFRRPLTSSPVQSTL
AGIASSNDAGCSNSCIGSSCGDINSTTTTSEPHFRLLQKLHVMPRCKGRFALSGFVAHRG
SGLSSGHYFTCVRHESAWRCFDDNNVTELTDREMQRFWGTPVDLGEVVTTTTAYLLLYER
VA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggggggaagttattccacggttaaaacgcagcgggagttgaggaatgctgacttgaag
gtctcacctaagtctccaaattcatttggaagaggcgatgtgcgaccaactccatcaaag
gcactcccgagtgccgcaagaggtacgttgcctacacgcgttgctcaggttaaagtccag
cgagagcaggggcaagatgagggcgcatcgcgagcacaggagtcatcatttcaggctttg
cctcatcttcctacttcacggagccaatccttttcgaatgtagcacaaaagtgtggtccg
ctatcgggtacaccaaatacgccatcaacgtcgttgtaccgaagcaacattctgtcacct
tcttccaccacagtaaatggtggtgtgttcggttctccctcgaccaccgccataccgacg
cgttcatcaccctctcagacgcaatacttggaaatcagtggttatccagtgggattggag
aactatggtaacacctgttacttcaatgcagtgctgcagttgctttaccactgttctcca
ctgcgcatgcgtatgctagagcttaatgcgatatacgagaagaaaaagggcagttcgcgg
ttcgatagtagcaccatacttgcgctcacagcagacctttttgcgaagatgcataaagtg
aacaataacaagaagcggcaaaagggtgtcccgacaccgcggggtttgctcaacagagtg
cggcagctcaactctatgttcaacaacaatcatcaacacgatgcacatgagtttgccatg
tttctcctgaacgaacttgttgagactgagtctcatttgatgtctgacgaaaggaatcgg
acactcttcatgcgggatgagggaaaagaatcgaagacatcacaatggttttcttccctc
tggtctcgtcgacagaaagaaaccaaaaaaggtgcggaaagatcacaatccgatgtgaag
gaagcaaatgagtcatgcacaacggtggactgtcttgaactcccgcgaatctttagcgag
ggtgaggtgtgtgccatgaaactcccttcattgacgaggttgaagagcagtgacttttca
gacggggttggtggcacaagtttgtactccacttctggttgggattggggcgctccacct
tctctggaaaagattttaactggtcagtttgtatcgcttacgggatgctgcgagtgtgag
aatgtgtccgttacccgtgaggcgttcattgatattggcctgaatgtcgtgcagggttca
tcgctgcgtcggtgcgtggaagagttgagtgtcacggaggtttttgatggagaaaacaaa
atgaattgtgagcggtgcggaaaaaaagttgcagcacggcgtgccatgtggattaatcgg
ctgcctgaatatgctttgttggtgcacctcaagcgctttcactacgacgagaagactgga
aaaatgagaaaacgaagcgagcacatcgccctcccgcgggagattgatgttgtggaatat
gaaccatgtggagaaaagtgcaatgaagcggctggtgatggatcattttgttgcgaagag
gacacctctggaccggaattccgccgccccttgacatcttctcccgtacaatcgacatta
gcagggatcgcatcttcaaatgatgcgggttgtagtaacagctgcattggctccagctgc
ggtgatatcaatagtacaaccactacgtctgagccacattttcggctgcttcagaagttg
catgtcatgccgcgttgcaaaggccgctttgctttaagtggtttcgtcgcccaccgtgga
agcggactcagctctgggcattattttacatgtgttcgtcatgaaagtgcgtggcgctgc
ttcgatgacaacaacgtgacggaactaacggaccgcgagatgcagcgtttctggggcacg
ccagtggatttgggcgaagttgtcaccaccaccacggcatatttgcttctgtacgagcga
gttgcgtaa

DBGET integrated database retrieval system