KEGG   Trypanosoma brucei: Tb10.70.7970Help
Entry
Tb10.70.7970      CDS       T01013                                 

Definition
(RefSeq) calcineurin B subunit, putative
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tbr  Trypanosoma brucei
Brite
Protein phosphatases and associated proteins [BR:tbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Tb10.70.7970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 3661499
NCBI-ProteinID: XP_822297
UniProt: Q38CK1
Position
10
AA seq 179 aa AA seqDB search
MEVAAVASAPSAEEVSELRKHTRLSEAQITRLHERFTALDRCGKGLISPSDFQSIASVAS
NPLLSRVLTVVSSSGDGNISFVDFAKAFAVFLPQTDRQEKLRFTYMMYDIDGDGKISNSD
LMEALKMMVGPNLTDVQLQQIVDKTFIEVDFNRDGFITFSDFEKLSLPISLDNAHVLQF
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggaagttgctgcggttgcgagtgctccctcggctgaggaagtgagcgaactgaggaag
catacgcgtctgtcagaggctcaaatcactcgactgcatgagcgtttcacggcacttgac
cggtgtggaaaaggtttgatttccccgagtgattttcagtcaatagcatccgtggcgtcc
aaccctcttcttagtcgagtgcttactgtggttagcagtagtggtgatggaaacattagt
tttgttgattttgcgaaggcattcgctgtttttctcccacagaccgataggcaggaaaag
ctgcgctttacgtatatgatgtatgatatcgacggtgatggcaaaatcagtaacagcgat
ctcatggaggctctcaaaatgatggtaggcccgaacttaacagatgtgcagctgcaacag
atagtagacaaaacatttattgaggtggacttcaaccgggacggttttatcacgtttagt
gattttgagaagctttcacttcccatcagtctggataatgcccatgttctgcagttttaa

DBGET integrated database retrieval system