KEGG   Trypanosoma brucei: Tb11.01.0450Help
Entry
Tb11.01.0450      CDS       T01013                                 

Definition
serine/threonine protein phosphatase catalytic subunit (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tbr  Trypanosoma brucei
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Tb11.01.0450
Enzymes [BR:tbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Tb11.01.0450
Protein phosphatases and associated proteins [BR:tbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Tb11.01.0450
Transcription machinery [BR:tbr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Tb11.01.0450
Spliceosome [BR:tbr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Tb11.01.0450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 303 aa AA seqDB search
MSVDVDAIIDKLLEVRLSKPGKQVSLSENDVKNLVMRSREILLSQPALLELEAPIKICGD
IHGQYYDLIRLFDNGGFPPSANYLFLGDYVDRGKQGLETICLVLAFKVKFPENFFILRGN
HECASINRIYGFFDECKRRYNIRLWKVFTDTFNCLPVACIIDDKIFCCHGGLSPDLQSME
QIKKIERPCDVADTGLICDLLWSDPEEGLSGWGENDRGVSYTFGQDIVAKFLSRHDFDLI
VRAHQVVEDGYQFFATRQLITIFSAPNYCNEFDNSGAVMSVDADLLCSFQILKPSVKKPK
YFQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagatgtcgatgccattatcgacaagcttctcgaagttcgtctgtcaaagcca
ggaaagcaggtgagcctgtctgaaaacgatgttaaaaaccttgtcatgcgaagtcgtgag
atccttctttcacaaccagcattgctcgaacttgaagcccctattaaaatatgtggggac
atccacgggcagtactacgatttgattcgtctatttgacaacggtggttttccaccttcc
gccaactatcttttcctcggggattacgtagaccgtggcaagcagggactggagacgatt
tgtcttgtcctcgcgtttaaggtgaagttccccgagaacttttttatattacgtggtaat
cacgaatgcgccagcatcaaccgcatctacggtttttttgacgaatgcaagaggcgctac
aacattcggctgtggaaggtgttcaccgacactttcaactgccttcccgttgcgtgcatt
attgacgataagattttctgctgtcacggcgggctttcccctgacctgcagtcaatggag
caaattaaaaagattgaacgcccatgcgacgttgctgacacgggactcatatgcgattta
ctctggtcggatccggaggagggtctctcaggctggggcgagaacgatcgtggtgtgtcc
tacacgtttggccaagatatcgtagcgaagtttcttagcaggcacgactttgatttgatc
gtgcgtgcgcatcaggtagtggaagatggctatcagtttttcgctacgcggcagctgata
acaatattctcggcgcccaactattgcaacgagtttgacaacagcggtgcagtaatgtct
gtagatgcggaccttctgtgctccttccaaatccttaagccatccgtaaagaagcccaag
tactttcagtag

DBGET integrated database retrieval system