KEGG   Trypanosoma brucei: Tb11.01.0450Help
Entry
Tb11.01.0450      CDS       T01013                                 

Definition
serine/threonine protein phosphatase catalytic subunit (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tbr  Trypanosoma brucei
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:tbr03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 303 aa AA seqDB search
MSVDVDAIIDKLLEVRLSKPGKQVSLSENDVKNLVMRSREILLSQPALLELEAPIKICGD
IHGQYYDLIRLFDNGGFPPSANYLFLGDYVDRGKQGLETICLVLAFKVKFPENFFILRGN
HECASINRIYGFFDECKRRYNIRLWKVFTDTFNCLPVACIIDDKIFCCHGGLSPDLQSME
QIKKIERPCDVADTGLICDLLWSDPEEGLSGWGENDRGVSYTFGQDIVAKFLSRHDFDLI
VRAHQVVEDGYQFFATRQLITIFSAPNYCNEFDNSGAVMSVDADLLCSFQILKPSVKKPK
YFQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagatgtcgatgccattatcgacaagcttctcgaagttcgtctgtcaaagcca
ggaaagcaggtgagcctgtctgaaaacgatgttaaaaaccttgtcatgcgaagtcgtgag
atccttctttcacaaccagcattgctcgaacttgaagcccctattaaaatatgtggggac
atccacgggcagtactacgatttgattcgtctatttgacaacggtggttttccaccttcc
gccaactatcttttcctcggggattacgtagaccgtggcaagcagggactggagacgatt
tgtcttgtcctcgcgtttaaggtgaagttccccgagaacttttttatattacgtggtaat
cacgaatgcgccagcatcaaccgcatctacggtttttttgacgaatgcaagaggcgctac
aacattcggctgtggaaggtgttcaccgacactttcaactgccttcccgttgcgtgcatt
attgacgataagattttctgctgtcacggcgggctttcccctgacctgcagtcaatggag
caaattaaaaagattgaacgcccatgcgacgttgctgacacgggactcatatgcgattta
ctctggtcggatccggaggagggtctctcaggctggggcgagaacgatcgtggtgtgtcc
tacacgtttggccaagatatcgtagcgaagtttcttagcaggcacgactttgatttgatc
gtgcgtgcgcatcaggtagtggaagatggctatcagtttttcgctacgcggcagctgata
acaatattctcggcgcccaactattgcaacgagtttgacaacagcggtgcagtaatgtct
gtagatgcggaccttctgtgctccttccaaatccttaagccatccgtaaagaagcccaag
tactttcagtag

DBGET integrated database retrieval system