KEGG   Trypanosoma brucei: Tb11.01.3550Help
Entry
Tb11.01.3550      CDS       T01013                                 

Definition
2-oxoglutarate dehydrogenase E2 component dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tbr  Trypanosoma brucei
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tbr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tbr00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tbr00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 383 aa AA seqDB search
MLRRLATHGLQATCLTSEKLAYRYCLSICVPTIAESISSGKVVGWTKKVGDAVAEDEIIC
QIESDKLNVDVRAPAAGVITKINFEEGTVVDVGAELSTMKEGEAPAAKAETADKPKQNAP
AAAAPPKASPTEAAPKPAPAAAPVTSRGADPRVRSVRISSMRQRIADRLKASQNTCAMLT
TFNEIDMTPLIELRNRYKDDFFKKNGVKLGFMSPFVKACAIALQDVPIVNASFGTDCIEY
HDYVDISVAVSTPKGLVVPVLRDVQNSNFAQIEKQIADFGERARSNKLTMAEMTGGTFTI
SNGGVFGSWMGTPIVNPPQSAILGMHATKKKPWVVGNSVVPRDIMAVALTYDHRLIDGSD
AVTFLVKVKNLIEDPARIVLDLA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtcgtttggccactcatggactccaagctacgtgcctgacttcggagaagttg
gcgtaccgctactgcctcagcatttgtgtccccactattgccgagtccatcagcagtggg
aaggttgtgggatggactaagaaggttggtgacgctgttgccgaagatgagattatttgt
caaattgagtcggacaaactcaatgtggatgtacgcgcccctgccgcgggtgtgatcacg
aagataaacttcgaagagggcactgttgtcgatgttggcgccgagctttcaaccatgaag
gaaggtgaggcccccgccgccaaggccgaaacagccgacaaaccgaagcagaatgcaccg
gcggcggcagcacctcccaaagcttccccaactgaagccgcgccaaagccagcgcccgcg
gctgctcccgtcacctcacgtggggcggacccgcgcgtacgtagcgttcgcatctcctcc
atgcggcagcgcattgcggatcggctgaaggcaagccagaacacgtgtgccatgctcacg
acattcaacgagattgatatgacccctcttatcgagttgcgcaatcgttacaaggatgat
ttcttcaagaagaacggggtgaaacttggattcatgtcgccattcgtgaaggcctgtgct
attgcacttcaggacgttcctattgtcaacgcatccttcggcactgactgcatcgaatac
cacgactacgtggacatcagtgttgccgtatccacaccgaaaggtcttgttgtgccggtc
cttcgtgacgtgcagaactccaactttgcccaaattgaaaagcaaatcgcagactttggt
gagcgcgcccgctcgaacaagctgaccatggcggagatgaccggtggcacattcactatt
agcaacggcggcgtgtttggctcgtggatggggacacctatcgtcaacccaccacagagc
gctattcttggtatgcacgccacgaagaagaagccgtgggttgtgggcaactccgtcgtc
ccgcgtgacataatggcggttgccctcacgtacgatcaccgtctcatcgacggcagtgac
gccgtaacatttctcgttaaggtgaagaacctcattgaggatcccgcacgtattgtgctc
gacctcgcctaa

DBGET integrated database retrieval system