KEGG   Trypanosoma brucei: Tb11.01.3550Help
Entry
Tb11.01.3550      CDS       T01013                                 

Definition
2-oxoglutarate dehydrogenase E2 component dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tbr  Trypanosoma brucei
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tb11.01.3550
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tb11.01.3550
  Amino acid metabolism
   00310 Lysine degradation
    Tb11.01.3550
Enzymes [BR:tbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tb11.01.3550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 383 aa AA seqDB search
MLRRLATHGLQATCLTSEKLAYRYCLSICVPTIAESISSGKVVGWTKKVGDAVAEDEIIC
QIESDKLNVDVRAPAAGVITKINFEEGTVVDVGAELSTMKEGEAPAAKAETADKPKQNAP
AAAAPPKASPTEAAPKPAPAAAPVTSRGADPRVRSVRISSMRQRIADRLKASQNTCAMLT
TFNEIDMTPLIELRNRYKDDFFKKNGVKLGFMSPFVKACAIALQDVPIVNASFGTDCIEY
HDYVDISVAVSTPKGLVVPVLRDVQNSNFAQIEKQIADFGERARSNKLTMAEMTGGTFTI
SNGGVFGSWMGTPIVNPPQSAILGMHATKKKPWVVGNSVVPRDIMAVALTYDHRLIDGSD
AVTFLVKVKNLIEDPARIVLDLA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtcgtttggccactcatggactccaagctacgtgcctgacttcggagaagttg
gcgtaccgctactgcctcagcatttgtgtccccactattgccgagtccatcagcagtggg
aaggttgtgggatggactaagaaggttggtgacgctgttgccgaagatgagattatttgt
caaattgagtcggacaaactcaatgtggatgtacgcgcccctgccgcgggtgtgatcacg
aagataaacttcgaagagggcactgttgtcgatgttggcgccgagctttcaaccatgaag
gaaggtgaggcccccgccgccaaggccgaaacagccgacaaaccgaagcagaatgcaccg
gcggcggcagcacctcccaaagcttccccaactgaagccgcgccaaagccagcgcccgcg
gctgctcccgtcacctcacgtggggcggacccgcgcgtacgtagcgttcgcatctcctcc
atgcggcagcgcattgcggatcggctgaaggcaagccagaacacgtgtgccatgctcacg
acattcaacgagattgatatgacccctcttatcgagttgcgcaatcgttacaaggatgat
ttcttcaagaagaacggggtgaaacttggattcatgtcgccattcgtgaaggcctgtgct
attgcacttcaggacgttcctattgtcaacgcatccttcggcactgactgcatcgaatac
cacgactacgtggacatcagtgttgccgtatccacaccgaaaggtcttgttgtgccggtc
cttcgtgacgtgcagaactccaactttgcccaaattgaaaagcaaatcgcagactttggt
gagcgcgcccgctcgaacaagctgaccatggcggagatgaccggtggcacattcactatt
agcaacggcggcgtgtttggctcgtggatggggacacctatcgtcaacccaccacagagc
gctattcttggtatgcacgccacgaagaagaagccgtgggttgtgggcaactccgtcgtc
ccgcgtgacataatggcggttgccctcacgtacgatcaccgtctcatcgacggcagtgac
gccgtaacatttctcgttaaggtgaagaacctcattgaggatcccgcacgtattgtgctc
gacctcgcctaa

DBGET integrated database retrieval system