KEGG   Trypanosoma brucei: Tb11.01.4060Help
Entry
Tb11.01.4060      CDS       T01013                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
tbr  Trypanosoma brucei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 790 aa AA seqDB search
MLSSSSPVLVSEQTCDKVDYGMELMPGKRLNTPVETPVIICPLYNLGNTCYFNAGVQLLV
NCPQFVYCLRDSLFRHPEHHRYAERVSRSCGKAALELFEAFTQLVNDMEFTQLEPDCAIS
PLRALECLSAVHPLFEGREQQDCPEMVNAVIANVAEVGRQEIELDNLLKSFEGDYLCLEK
AMGCRRGDTSFVPMRCTRQRMEFDEISLQSGSLYGSDQMNRNGAASANHEQNENGSENNH
FTTSAQTHNAPQFPVFPGSWWNFNTMRINQFVNRENRLLQLQEDSKNGKLPQSTFRPPKI
FYNSVTDGFTGQILSEIRCHTCQRSSRIVESFSSLTIGIPSPRQRLQYAKKHPEVQRVKQ
DGTPQNLARSLYWRSVFSWFYAATRWIVGLFTGFSRRGNCPVTLQECLDIHFEPVELKGS
NMYHCSTCNAKREATKQETLLTMPEYLLLHMKRFEQGKCFNTKKTDEVIFPMSWDVGAAQ
STDVLRLRNYLDSNVLAFNYPLSTFHGTTSAGDSTPMENSTSVTTPLTATNDHQKFAAAS
SSPLQSMQTRENPDIEAPIDTYTLEAVVNHHGTIARGHYTTFARKKTASKDVWVYLNDEE
LSTTTADSVANSEEYLLLYKKQSLFPRSEAFEKLRTKARELLAKPLSSRMGLDAAGVDKS
SRNPNSNTNLSISGGGDGCHDVVYISRPWLQRMTFMEEPGPILNRLSYRAATQETGESSS
AHGTQSSPKQNLGEPTSAKGPPYEKSLPVEWFYVSLLQQEYDAFYDMYGGNQAVTQSEYN
LMMSEQDALV
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcatcttcgtcgccggttttggtttctgagcagacatgcgataaggtcgactat
ggcatggaactaatgcctggtaagagattaaatactcctgtggaaacaccagtgattatt
tgtccactgtacaaccttggaaacacatgctattttaatgccggtgttcagttgcttgta
aactgccctcaatttgtgtactgcctccgtgactcgctgtttcgccacccggagcatcac
cgctacgctgaacgcgtaagccgttcgtgcggtaaggcagcactggagttatttgaggcc
tttactcaattggtcaatgatatggagttcactcaacttgaacctgactgcgcaatctcg
ccactgagggcgttggaatgcctttccgctgttcatccgttgtttgagggccgcgaacag
caggactgtcctgaaatggtgaacgcggtgattgctaacgtggcggaggtggggcggcaa
gaaatcgaattggacaacttgctgaagtcctttgaaggggattatctgtgcttggaaaag
gcaatggggtgtcggcgaggtgacacatcgtttgtgcccatgcggtgcacgaggcaacgg
atggagttcgatgagataagtttgcagtctggttctttatatggaagtgaccaaatgaat
cgaaatggggcagcatctgccaaccatgaacagaatgaaaatggttctgagaacaaccat
tttacaacctctgctcaaacgcacaacgcaccccagtttccagtgtttccgggaagttgg
tggaacttcaatacaatgagaatcaaccaatttgtaaaccgtgagaataggttgcttcag
cttcaggaagactccaagaatggaaagcttccccaaagcacgtttcgaccacccaaaata
ttttacaacagtgtgactgatggttttaccggtcaaatactctccgaaatacggtgccac
acttgccaaagaagctctcgtattgtggagagtttttcttcgctgacaattggaatccca
tccccccggcagaggctccaatatgctaaaaagcatccggaggttcagcgcgtcaaacag
gatgggacacctcagaacctcgcacggtcgctttattggcgtagtgttttctcgtggttc
tatgctgcgacacggtggattgttggtctgtttacgggcttttcgagacgaggaaattgc
cctgtgacgttgcaggagtgcctcgacatccattttgagccggtggaactgaagggtagc
aacatgtatcattgcagcacatgcaatgccaaacgggaggcaactaagcaggagactctc
ctcacaatgcccgagtacctactgttacatatgaaacgcttcgaacaggggaagtgtttc
aataccaagaaaacagatgaagtcatcttccccatgtcgtgggatgtaggcgctgctcaa
agtacagacgtgctgcggttgcgtaactatttggactcgaatgttttagcgtttaattac
ccactctcaacattccacggaacgactagtgcaggtgatagcacacctatggaaaactca
acgtctgtcacaacccccctaacagctactaacgaccaccagaagtttgccgcagccagt
tcgtctcctttgcaaagtatgcaaacaagggaaaacccggatattgaggccccaatcgat
acctacaccttagaagccgtcgttaaccatcacggaactattgctcgtggccactacaca
accttcgcgcgtaagaagactgcgtcgaaagacgtgtgggtttacctgaacgatgaagag
ttgagcaccactactgctgactccgtggcgaattcggaggagtacctacttctatataag
aagcaatctctcttccctcgctccgaggcgttcgagaaacttcgcacgaaggcacgagag
ctgttggcgaaaccactgtcatcgcgtatgggcttggatgccgctggcgtagacaagagt
agcaggaatccgaatagcaacaccaacctttccatatctgggggcggagacggttgtcat
gatgtggtttacatttcccgaccgtggctgcagcgtatgacttttatggaggagccgggt
cctatcctcaaccgcctttcctatcgcgccgccacgcaagaaacaggggagtcctcgtcg
gcacatggtacgcaaagttcaccaaaacaaaatctgggggagccaacttctgcaaagggg
ccaccttacgagaaaagcctccccgtcgagtggttctatgtatcccttctgcaacaggaa
tatgacgcattttacgacatgtatggtggaaaccaggcggtgactcagagtgaatacaat
ttaatgatgagtgaacaagacgcactcgtatga

DBGET integrated database retrieval system