KEGG   Trypanosoma brucei: Tb11.01.5350Help
Entry
Tb11.01.5350      CDS       T01013                                 

Definition
profilin
Orthology
K05759  
profilin
Organism
tbr  Trypanosoma brucei
Brite
Exosome [BR:tbr04147]
 Exosomal proteins
  Proteins found in most exosomes
   Tb11.01.5350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 150 aa AA seqDB search
MSWQSYVDDSLVGSGFMHSAAIVGLADGSYWAYGGTYVPQPEEVTHILKCLENFSLVQSS
GVTICGVKFFGLQSGSEGQMKYIFFKKGAAGGCIYTSKQTAIIAVYGNPGDASALQQDLQ
KTEATYVAVNPADCNTTVKRIAEYLISLDY
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagtcctacgtcgacgacagccttgttggcagtggtttcatgcacagcgca
gcgatcgttggtcttgctgatgggagttactgggcgtatggaggaacatatgtgccgcag
cctgaggaggtaacacacattctcaagtgtctggagaatttctcgctcgtacaaagttcc
ggtgtaaccatctgtggtgtcaagttcttcggtcttcagtcaggatccgaaggtcagatg
aagtacatattctttaagaaaggagccgcagggggttgcatatacacttccaaacaaact
gctattattgctgtttacggcaaccctggtgatgcatcagccttgcagcaggatctccag
aagaccgaagctacatatgtggctgtcaatccggcagactgcaacacgacagtaaagaga
attgcggagtatttgattagcttggactactga

DBGET integrated database retrieval system