KEGG   Trypanosoma brucei: Tb11.01.8200Help
Entry
Tb11.01.8200      CDS       T01013                                 

Definition
enoyl-CoA hydratase/isomerase family protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
tbr  Trypanosoma brucei
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tbr01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tbr00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:tbr00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:tbr00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 362 aa AA seqDB search
MRCTLPLCSKGLFWRDFPNTRLVTLNREKALNALNLEMVREMSLAYFHEHHPKGDNALFV
VKGMGEKSFCAGGDIVMITTDNSVVNEFFYREYQLNHRILTMPNPQVSLWNGYVMGGGVG
ISVHGRYRVASERAIFAMPENGIGLFPDVGASWFLPRLKLPGFGLYLGLTGGRVKGADLV
HLGLATHYVPAASFEQLEDRLCHIEDSTKVDACLNEFAVKDLPPFTLEEHRPLIEKVFTL
KDTSTVEDVMGSLAADGGEFARTAISTMEKLSPTSLKLALKMQQMGAKATDPAEVFSTDY
VGAIRTHACGDFPEGVRALLIDKTKDPKWNPGKLSDVTPEHLAKFFEPLGPDMRKWHPTE
PY
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgcacgcttccgctatgctcaaaggggttgttctggagggactttccgaacacc
cgtttggttacgttgaatcgtgaaaaagcgctaaatgctcttaacctggagatggtgagg
gaaatgtctttggcttatttccacgaacaccacccgaagggggacaacgctctgtttgtt
gtgaagggcatgggtgagaaaagcttctgtgcgggtggcgatatcgtcatgattactaca
gacaacagcgtagtgaacgagttcttttaccgggagtatcaattaaaccatcgtatcctc
actatgccaaacccacaagtgtcattatggaacggctatgtgatgggcggaggtgttggc
atctcagttcatggtcggtatcgtgtggcgtcagaacgcgctatttttgccatgcctgag
aatggtattgggctttttcccgatgtgggcgcctcctggttcctgccgcggctgaaattg
cctggttttggactgtacctcggcctcacggggggacgtgtgaagggagcggatttggtg
catctcggtctcgccactcattatgtccccgccgcctccttcgagcaactggaggaccgg
ttgtgtcatatcgaagactccacaaaagtcgatgcgtgtttgaacgaattcgctgtgaag
gatctgccacctttcactttggaggaacaccgccctcttatagaaaaggtttttacgctg
aaggatacctctacggtggaggatgttatggggtcgcttgctgcagacggtggtgagttt
gcacgcactgccatctccacaatggaaaaattatctccaacaagtcttaagctcgccctg
aagatgcagcagatgggggcgaaggcaacagatcctgcagaggttttcagcaccgattac
gtgggtgccattcgtactcatgcctgtggtgacttccctgagggagtgcgggctttgctt
attgacaaaacaaaggatcccaagtggaatcctggaaagctgtcagacgtaactcccgaa
catttggcgaagttctttgaacccttggggcctgatatgcggaaatggcatcccacagag
ccgtactag

DBGET integrated database retrieval system