KEGG   Trypanosoma brucei: Tb11.01.8200Help
Entry
Tb11.01.8200      CDS       T01013                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase family protein, putative
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
tbr  Trypanosoma brucei
Pathway
tbr00280  Valine, leucine and isoleucine degradation
tbr00410  beta-Alanine metabolism
tbr00640  Propanoate metabolism
tbr01100  Metabolic pathways
tbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tb11.01.8200
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tb11.01.8200
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tb11.01.8200
Enzymes [BR:tbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     Tb11.01.8200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 3664538
NCBI-ProteinID: XP_829705
UniProt: Q381D8
Position
11
AA seq 362 aa AA seqDB search
MRCTLPLCSKGLFWRDFPNTRLVTLNREKALNALNLEMVREMSLAYFHEHHPKGDNALFV
VKGMGEKSFCAGGDIVMITTDNSVVNEFFYREYQLNHRILTMPNPQVSLWNGYVMGGGVG
ISVHGRYRVASERAIFAMPENGIGLFPDVGASWFLPRLKLPGFGLYLGLTGGRVKGADLV
HLGLATHYVPAASFEQLEDRLCHIEDSTKVDACLNEFAVKDLPPFTLEEHRPLIEKVFTL
KDTSTVEDVMGSLAADGGEFARTAISTMEKLSPTSLKLALKMQQMGAKATDPAEVFSTDY
VGAIRTHACGDFPEGVRALLIDKTKDPKWNPGKLSDVTPEHLAKFFEPLGPDMRKWHPTE
PY
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgcacgcttccgctatgctcaaaggggttgttctggagggactttccgaacacc
cgtttggttacgttgaatcgtgaaaaagcgctaaatgctcttaacctggagatggtgagg
gaaatgtctttggcttatttccacgaacaccacccgaagggggacaacgctctgtttgtt
gtgaagggcatgggtgagaaaagcttctgtgcgggtggcgatatcgtcatgattactaca
gacaacagcgtagtgaacgagttcttttaccgggagtatcaattaaaccatcgtatcctc
actatgccaaacccacaagtgtcattatggaacggctatgtgatgggcggaggtgttggc
atctcagttcatggtcggtatcgtgtggcgtcagaacgcgctatttttgccatgcctgag
aatggtattgggctttttcccgatgtgggcgcctcctggttcctgccgcggctgaaattg
cctggttttggactgtacctcggcctcacggggggacgtgtgaagggagcggatttggtg
catctcggtctcgccactcattatgtccccgccgcctccttcgagcaactggaggaccgg
ttgtgtcatatcgaagactccacaaaagtcgatgcgtgtttgaacgaattcgctgtgaag
gatctgccacctttcactttggaggaacaccgccctcttatagaaaaggtttttacgctg
aaggatacctctacggtggaggatgttatggggtcgcttgctgcagacggtggtgagttt
gcacgcactgccatctccacaatggaaaaattatctccaacaagtcttaagctcgccctg
aagatgcagcagatgggggcgaaggcaacagatcctgcagaggttttcagcaccgattac
gtgggtgccattcgtactcatgcctgtggtgacttccctgagggagtgcgggctttgctt
attgacaaaacaaaggatcccaagtggaatcctggaaagctgtcagacgtaactcccgaa
catttggcgaagttctttgaacccttggggcctgatatgcggaaatggcatcccacagag
ccgtactag

DBGET integrated database retrieval system