KEGG   Trypanosoma brucei: Tb11.02.1230Help
Entry
Tb11.02.1230      CDS       T01013                                 

Definition
NADH-cytochrome b5 reductase (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tbr  Trypanosoma brucei
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tb11.02.1230
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Tb11.02.1230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 306 aa AA seqDB search
MMLAVIVAFAVIFFVTLALAGRGLLPFYRYPPIALNPDVYQSFKLVKKTRVTHDSFIFRF
ALHASHQCLGLPTGHHIRFRVASKHNFTGTPQVVQHSYTPISSNDDKGFVDFLVKIYYKG
SNPAFPNGGRLSQHLDSLSIGEAVEMLGPVGKFQYMGNGDYTVEMGKGEVKRQHVAGFAM
VAGGTGITPMMQIIHAILKSPEDPTRLWLVYSNHTEEDILLRDALAEACKDPRVKVWHTL
TRSAPPDWAYGRGRVNEEMLRTHLPPPQLEEGSVTVLLCGPPLMLQDAVKPNLLNIGYSQ
DNIFTF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcgcagttatcgtagcttttgcggtcattttttttgttacgttggctcttgcc
ggccgggggcttcttcctttttatcgttatcctcccatcgccctcaacccagacgtatat
cagtcgttcaaacttgtgaagaaaactcgcgtgacgcatgattctttcatttttcgcttt
gccctccacgcctcgcatcaatgccttggtttaccgacgggtcaccacattcggttccgt
gtcgcgtccaaacacaactttacgggcaccccacaagttgttcagcactcttacactccc
atttcatcaaatgacgacaagggattcgtggatttccttgtgaaaatatattacaagggc
tccaatccggcattccccaacggtgggcggctctcacaacatcttgacagtttgtccatt
ggtgaggctgtggagatgttgggcccagtggggaagtttcagtacatgggaaacggtgac
tatacggtggagatgggtaagggagaggtaaagcggcagcatgtagctggttttgcaatg
gttgctggtggtacagggattacaccaatgatgcaaattattcatgccatacttaaatca
cctgaggatcccacgcggctttggttagtctattccaaccacacagaagaggacatttta
ctgcgggatgcactagccgaggcatgtaaggacccgcgtgtgaaggtatggcacactctc
actcgcagtgcccccccggattgggcgtatggaagagggcgtgttaacgaagagatgctt
cgcactcacctccccccaccgcagctggaggagggctcagtaaccgtattgttatgtggt
cccccgcttatgcttcaggacgcagtgaagccaaacctgctcaacattgggtactcacaa
gacaatatatttaccttttaa

DBGET integrated database retrieval system