KEGG   Trypanosoma brucei: Tb11.02.2390Help
Entry
Tb11.02.2390      CDS       T01013                                 

Definition
pyruvate dehydrogenase (lipoamide) kinase (EC:2.7.1.99)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Tb11.02.2390
Protein kinases [BR:tbr01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   Tb11.02.2390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 445 aa AA seqDB search
MFRCYGRKLSPQLRDIIHRLDFIEKQIIDLKAFRDAVQATLPSVATAADALARKRQETAN
QINVVAKDPLTSEEFVELNQYYAVQMVQTLALRNMVHIRTHEDLYSHARLIHREYLVRVA
QRARALSHACVGLSQMPSIQELRRWYEWSFHDVRSTKAPVDAEGALKFDTLVRRLFLRHY
NVSALLSEGMHELGERQRWDEHSHSDDLLTETFDELQRFFDEFCMGRVRLRFLVGNYVQL
STQILRVEPRYSEKLTAPMYFDHDPESFVGQICQRCSLIKLVECAIRSARASYSELGIEL
RVAVDPDATLSGIPYITYDILSALIDDAIQANVLRQEKYGIPFTPVVITIAQRNANEQFS
VRVSDTAGGMPLHLARHVLKYWFAYKCTDDMLKLAKTWTHSPIRLPYAYCAAKVLGGDIS
VVSIDGYGTDRFLHLPSDGIERVRF
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggtgttatggacgaaaactgagtccccaactacgtgacattatacaccgactg
gactttattgaaaaacagattattgatctcaaggcttttcgagatgcggttcaggcgacg
ttgccaagcgttgcgaccgctgctgatgctctagctaggaagcgccaagaaacagcaaac
caaatcaatgtagtggcgaaggatcctttgacgtccgaggagttcgtagaactgaatcaa
tattatgccgttcaaatggttcaaacgttagcacttcgtaatatggtgcacataaggacg
catgaggatctatattcacacgcccgattaattcacagagagtatcttgtacgtgttgca
cagcgggcccgcgcacttagtcatgcatgtgtggggttgtctcagatgccttctattcag
gaactacgcaggtggtatgagtggagtttccatgatgtgaggagtacgaaagctccagtc
gatgctgagggcgctctgaaatttgatacactagttagacgtctttttttgaggcactac
aacgtgagcgcacttcttagcgagggcatgcacgaacttggggagcgccaaaggtgggat
gaacactctcactccgatgacctccttaccgaaacatttgacgagcttcaacggttcttc
gatgaattttgtatgggtcgtgtgaggttgcgttttctcgtgggaaattatgttcagttg
tcgacgcaaattttgcgggtggaaccacggtactctgagaagcttacagctcccatgtat
tttgaccacgaccccgagagctttgttggacaaatatgccaacgatgctcattaataaaa
ctagtagagtgcgcgatacgttctgcaagggcgtcttacagtgagttgggtattgagctc
cgtgtagctgtagatcctgatgcaacgctatctgggattccatacattacgtatgatatt
ttatctgcgttaattgacgatgccattcaggctaatgttctacggcaggaaaagtatgga
ataccattcacgccagttgtgatcactattgctcaacgcaatgccaatgagcagtttagt
gtccgtgtttccgatactgccggcgggatgccccttcatcttgcccgacacgtgttgaaa
tattggtttgcgtacaagtgcacggatgacatgttgaaactcgctaaaacatggacacat
agtcccatacgtctaccatatgcttactgtgcagccaaggttttagggggggatatatca
gtggtttccattgatggttatggcaccgaccgttttcttcatcttccgtccgacgggata
gagagggttcgtttttag

  All links  
No link information was found.   
DBGET integrated database retrieval system