KEGG   Trypanosoma brucei: Tb11.02.2800Help
Entry
Tb11.02.2800      CDS       T01013                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.4.19.12)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Tb11.02.2800
Peptidases [BR:tbr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Tb11.02.2800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 309 aa AA seqDB search
MPSWCLIESDPAVFTELIQRFGAQGVAVEEIVQLEQEYLRVHTNVYGLILLFKWKARKEG
AATDGVVVPDAPVFFVQQTVNNACATLSIVNILLNHKESIELGEVLGNFLSFTQDMNPYL
RGTQVGECDALREAHNSFAPVELFSLDHSVPDAGDAYHFVSFVYKNSAIWELDGLQEGPI
LASDASDENYRDKLMEVVRKRIRDHSAEDTTGAGQGISFSLMAVVDDPLVLLERRIYEAT
LQEAPTHYLEEQLNQLTKQRAREKLENQRRRHNYVPMIVELLKALAEKGQLKGILDDALA
KKSGQGAKQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcccagttggtgtcttattgaaagcgatccagcggttttcacggagcttatccaacgg
ttcggcgcccaaggcgtggccgttgaggaaatcgtacagcttgagcaggagtatctacgc
gtccacactaatgtctacggtctgattcttcttttcaaatggaaagcaaggaaggaaggt
gctgcgactgatggtgtagtcgttccagatgcccctgtatttttcgtccagcagactgtt
aacaacgcctgtgccacgctttccatcgtgaatattctcctgaaccacaaggagagtatt
gaacttggggaggtgttaggcaattttctctccttcacccaggacatgaatccgtatctt
cgaggcacgcaagtgggcgagtgtgatgcccttcgtgaggctcacaactcttttgcgccg
gtggaactcttctctttagaccatagtgtgcctgatgcaggcgatgcataccactttgtt
tcgtttgtgtacaagaacagtgccatatgggaactagatgggcttcaggagggacctatt
ctcgcctccgatgctagtgatgagaactacagggacaaactgatggaagttgtgcggaaa
cgcatcagggatcacagcgctgaggacacgacaggagctgggcaggggatttccttctct
ctcatggctgtggttgatgatccccttgtattgttggagaggagaatatacgaagcgaca
ctacaggaggcccccacgcattatttggaggagcagttgaatcaactgacgaaacagcgt
gcgcgtgaaaaactcgaaaaccagcgcaggcgtcataattacgttcctatgatcgtggag
ttgttgaaggcactcgctgagaaggggcagttgaaggggatcttggacgatgcgctcgca
aaaaaaagtggtcaaggggctaagcagtag

DBGET integrated database retrieval system