KEGG   Trypanosoma brucei: Tb11.02.2940Help
Entry
Tb11.02.2940      CDS       T01013                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K01072  
ubiquitin thiolesterase [EC:3.1.2.15]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Tb11.02.2940
Peptidases [BR:tbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Tb11.02.2940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 765 aa AA seqDB search
MDIVNNNGSFVTRTTVSRPIPFERYRKPCIATYPRSAVFLNKRRANELHCSGAPGNENGS
DDNASSLAFGEDNGKNEAADDDDPLNIDPETMLCSDEQLKQVLALRWRDVGPNGCGLQNM
GNTCFINCVLQAIAYTPALSQYFSTTFRSPHTDRVLNAPFDYAYALGETIRKIHTPSRNA
YKPTVIISNIKVLSPHFRLGVQGDAHEFAVHLLHACHRSILFRQVGSRKLPQHIEQTSTL
QRIVGGYLRSTVTWSRREEIHYLLKEGNLQEASNLKMNANSRKSDSDDGHKELISNTYDP
FVTLSPEICGQTLEHCLSKLCAKERLEGRVYITPRGVTVNATKQFMLHKLPNVLIIHLKR
FNEFGAKVGKFVRYPKILNVGPFCTTDGTLKKLRNHKRRGYKPSNGPASCDSSIYNSEAS
NRSVECLYELNAICVHQGSSLSHGHYFSVVRARNESWIECNDGHISHCSEDHALSQSAYM
LFYSRVAESSATPDIKCSRDNHTTHRGMELSSGRVKPFTGSTPRKIVGECPTSDVGRELT
DQEALRLIGKKREVPQQQLVQTNGEKRVQHVGLPARLKGLNTKSSSSTAVRDNSSNNSLW
SEQETCSSSYASSAAFDREENSVCSSRKNSAPDRYCGIVKALKVNGSRDVGKGGTSPTDP
LGGHRSSVVGEEVLRAMEKHKLEAPLTVMRQPHAPKFRQQVRDPLWEQEMDRGRTKRSRL
KRDESTDEENKFQKADIGFDSRGRRLLNQRNERANGRSFAHGKFS
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgttaataacaatggttcttttgtgacacgcactactgtttcccgtcccatt
ccgtttgagcgctatcgtaaaccgtgcatcgccacttacccgagaagtgccgtttttctc
aacaagcgccgcgcgaatgagctacattgcagtggcgcacccggaaatgaaaatggaagt
gatgacaatgcgtcttccctcgcctttggtgaagataatggaaagaatgaggcggcagac
gatgacgacccgctgaacatcgacccagaaacaatgctttgctccgatgagcaactaaaa
caagtgcttgctctccgctggcgcgacgttggtcctaacggatgcgggttgcagaacatg
ggaaatacatgctttatcaattgcgtgcttcaagcgatagcgtatacacctgctctttcg
caatacttttcgactactttccgttctccacacacagaccgggtgttgaatgcgccattt
gactacgcttatgctttgggagagacaattcgtaaaatacacactccttcgagaaacgca
tataaaccaaccgtaatcatcagcaacattaaggtgctttcaccacactttcgccttgga
gtgcaaggtgacgcgcatgaatttgccgtgcacctgctgcatgcgtgccaccgttcaatt
ttgtttaggcaagtgggttctcgtaagctgccgcaacacatcgaacaaacttcgacatta
cagcggatcgttggtggttaccttcgttccactgtcacttggagtaggcgggaggagatt
cattacttgttaaaggaggggaaccttcaggaagcaagtaacttaaagatgaacgcgaat
tcgcgcaaaagtgatagtgatgatggacacaaggaactcatctccaacacatatgatcca
tttgtgacgcttagcccagagatctgtggtcaaacgctcgaacactgtttgtccaaactc
tgcgcgaaggaaaggttggagggacgggtgtatataacgcctcgcggcgttaccgtgaac
gctactaaacaatttatgttgcataagttaccgaatgttttaattatccatttgaaacgt
ttcaatgagttcggggcgaaggttgggaagtttgtacgatacccgaagatactgaacgtg
gggcccttttgcacgaccgatggaacgttgaaaaagctacgtaaccacaagaggaggggt
tacaagccctcgaatggtcccgctagttgtgacagcagcatttataatagcgaagcgagc
aataggtcagttgagtgcctatacgaattgaacgccatttgtgtccaccagggttcctcg
ctctcccatgggcactacttcagtgttgttcgcgcacgcaatgaatcgtggattgagtgc
aatgatggccacatttcacattgcagcgaggaccatgccctatcgcagtcagcgtatatg
cttttctactcccgagtagcggaaagctctgccacgcccgatatcaagtgcagtcgagac
aatcatacaacacacaggggcatggaactatcatcgggtcgtgttaaaccctttacggga
agtacaccacgtaaaatagtgggtgagtgccctactagcgatgtaggtcgtgagttaacc
gaccaagaggcgctacgacttattggaaagaagagagaagtaccccagcagcagttagta
cagacgaacggtgagaagagagttcaacatgttggtcttccagctaggttgaaaggactc
aacaccaagtcgtcatcatctactgctgtacgggacaacagctccaacaactcactgtgg
agtgaacaggagacgtgttcatcttcctacgcttcctcggcggctttcgacagagaagag
aattcagtttgttcttctcggaagaatagtgcacccgacagatattgcggaatagtgaaa
gccctaaaggtaaacgggtcgagggatgttggaaagggagggacttctccaactgaccct
ttggggggccacagaagcagcgttgtgggggaggaggtgttgagggctatggaaaagcat
aagctggaggctccattgactgttatgcgtcaaccccatgcgccaaagtttcgacagcaa
gtgcgagatcctttgtgggagcaggagatggatcgtggccgtacaaagcgatcaaggttg
aagcgggatgaaagcacggatgaggagaacaaatttcagaaggcagacattgggtttgac
agccgtggaaggcgtctcctgaaccaacgaaatgaacgagctaacggccggagtttcgcc
cacggaaaattctcgtaa

DBGET integrated database retrieval system