KEGG   Trypanosoma brucei: Tb11.02.3210Help
Entry
Tb11.02.3210      CDS       T01013                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tbr  Trypanosoma brucei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tb11.02.3210
   01230 Biosynthesis of amino acids
    Tb11.02.3210
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tb11.02.3210
   00051 Fructose and mannose metabolism
    Tb11.02.3210
   00562 Inositol phosphate metabolism
    Tb11.02.3210
Enzymes [BR:tbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tb11.02.3210
Exosome [BR:tbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tb11.02.3210
  Exosomal proteins of bladder cancer cells
   Tb11.02.3210
  Exosomal proteins of melanoma cells
   Tb11.02.3210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
11
AA seq 250 aa AA seqDB search
MSKPQPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVASTFVHLAMTKERLSHPKF
VIAAQNAIAKSGAFTGEVSLPILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVAAG
FMVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPVWAIGTGKVATP
QQAQEAHALIRSWVSSKIGADVAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASLKP
EFVDIIKATQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccacaacccatcgcagcagccaactggaagtgcaacggctcccaacagtct
ttgtcggagcttattgatctgtttaactccacaagcatcaaccacgacgtgcaatgcgta
gtggcctccacctttgttcaccttgccatgacgaaggagcgtctttcacaccccaaattt
gtgattgcggcgcagaacgccattgcaaagagcggtgccttcaccggcgaagtctccctg
cccatcctcaaagatttcggtgtcaactggattgttctgggtcactccgagcgccgcgca
tactatggtgagacaaacgagattgttgcggacaaggttgccgccgccgttgctgctggt
ttcatggttattgcttgcatcggcgaaacgctgcaggagcgtgaatcaggtcgcaccgct
gttgttgtgctcacacagatcgctgctattgctaagaaactgaagaaggctgactgggcc
aaagttgtcatcgcctacgaacccgtttgggccattggtaccggcaaggtggcgacacca
cagcaagcgcaggaagcccacgcactcatccgcagctgggtgagcagcaagattggagca
gatgtcgcgggagagctccgcattctttacggcggttctgttaatggaaagaatgcgcgc
actctttaccaacagcgagacgtcaacggcttccttgttggtggtgcctcactgaagcca
gaatttgtggacatcatcaaagccactcagtga

DBGET integrated database retrieval system