KEGG   Trypanosoma brucei: Tb11.02.3210Help
Entry
Tb11.02.3210      CDS       T01013                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tbr  Trypanosoma brucei
Pathway
tbr00010  Glycolysis / Gluconeogenesis
tbr00051  Fructose and mannose metabolism
tbr00562  Inositol phosphate metabolism
tbr01100  Metabolic pathways
tbr01110  Biosynthesis of secondary metabolites
tbr01130  Biosynthesis of antibiotics
tbr01200  Carbon metabolism
tbr01230  Biosynthesis of amino acids
Module
tbr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tbr_M00002  Glycolysis, core module involving three-carbon compounds
tbr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tb11.02.3210
   00051 Fructose and mannose metabolism
    Tb11.02.3210
   00562 Inositol phosphate metabolism
    Tb11.02.3210
Enzymes [BR:tbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tb11.02.3210
Exosome [BR:tbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tb11.02.3210
  Exosomal proteins of bladder cancer cells
   Tb11.02.3210
  Exosomal proteins of melanoma cells
   Tb11.02.3210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 3665619
NCBI-ProteinID: XP_828627
UniProt: Q385L6
Structure
PDB: 

Jmol
Position
11
AA seq 250 aa AA seqDB search
MSKPQPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVASTFVHLAMTKERLSHPKF
VIAAQNAIAKSGAFTGEVSLPILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVAAG
FMVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPVWAIGTGKVATP
QQAQEAHALIRSWVSSKIGADVAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASLKP
EFVDIIKATQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccacaacccatcgcagcagccaactggaagtgcaacggctcccaacagtct
ttgtcggagcttattgatctgtttaactccacaagcatcaaccacgacgtgcaatgcgta
gtggcctccacctttgttcaccttgccatgacgaaggagcgtctttcacaccccaaattt
gtgattgcggcgcagaacgccattgcaaagagcggtgccttcaccggcgaagtctccctg
cccatcctcaaagatttcggtgtcaactggattgttctgggtcactccgagcgccgcgca
tactatggtgagacaaacgagattgttgcggacaaggttgccgccgccgttgctgctggt
ttcatggttattgcttgcatcggcgaaacgctgcaggagcgtgaatcaggtcgcaccgct
gttgttgtgctcacacagatcgctgctattgctaagaaactgaagaaggctgactgggcc
aaagttgtcatcgcctacgaacccgtttgggccattggtaccggcaaggtggcgacacca
cagcaagcgcaggaagcccacgcactcatccgcagctgggtgagcagcaagattggagca
gatgtcgcgggagagctccgcattctttacggcggttctgttaatggaaagaatgcgcgc
actctttaccaacagcgagacgtcaacggcttccttgttggtggtgcctcactgaagcca
gaatttgtggacatcatcaaagccactcagtga

DBGET integrated database retrieval system