KEGG   Trypanosoma brucei: Tb11.02.3780Help
Entry
Tb11.02.3780      CDS       T01013                                 

Definition
phosphoinositide-specific phospholipase C (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tbr  Trypanosoma brucei
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tbr00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:tbr04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 714 aa AA seqDB search
MGGCTSRGLSEEKLACYSHRTGNLVDEHLSTGAVEAHELQPFFSSLLGAITDLLKCSRED
AVEFLACASSANPRAAELFTSFCAANPLNLIKWDVNHAKFMMIWIKYDDDNSGDICVREL
RKILKGLSFPERLSQKMIDELEATGGRANYKLMQGTFMSLTRLNELTYAMRNIVGPDRDV
MTKAEFVTFLKETQGEGADGEELHVFLDAVGCTEEHPVHLDAFLSFLSDRRFNSIVNNRK
VSSVYHDMTRPICEYFINSSHNTYLTGDQLLSKSSTDMYKRVLLDGCRCVELDCWDGRKG
QPVVYHGYTRTSKLWFRDCISTIKKYAFVNSIYPVILSLEVHTSLRQQDRMAEILCETLG
DMLFCSPWGAGEQTSFTFSPEALKGKILLKSKRATTPTDGVQVDDDDDEDEEADGVVENF
VPPETARRCRGGGKTNSRGAEKKKKVSKVSEKLSRLISIESIGYKGVEDLSYLEMRQPYH
CSSFTEGKAGKIASSNQEEFVAINNRCLSRIYPTGTRIGSSNFHPQTFWNCGCQLVALNW
QNYKSYQLRLNRGFFSDNGNCGYLLKPTAVDIARARGPKRQSRLLTIEIISAFCLPRRKN
ASGSSIVDSRVAALIEGPGMEKSQRNTSPIHNNGFHPVWRGERLNNEFCWKVYEWELSTL
VMQVYDEDTKSNNLLGEYVVPLRALKKGIRQVPLRDLKGSIIHGSFLMVQVSYQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgggagggtgtacgtcacgtgggctctcagaagagaaactcgcatgttactcccaccgt
accggcaacctcgttgatgagcatctttcgacaggggcagttgaggcacacgagcttcag
cccttcttttcttctctgctgggagccatcacggaccttttgaagtgcagccgggaggat
gccgtcgagttccttgcatgcgcaagtagtgcaaacccacgggcggcagagttgtttact
tccttttgtgctgcaaatccgctgaatctcataaaatgggatgtgaatcacgcgaagttc
atgatgatatggataaagtacgacgacgacaacagcggggacatatgcgttcgtgaattg
aggaaaatcttgaagggtttgagcttccctgaaaggctctcacaaaagatgattgacgag
ctggaagctacaggggggagggcaaactacaagttgatgcaggggacatttatgtctctg
acaagacttaatgaactgacatatgcaatgcgaaatattgtgggtcccgatcgggacgtg
atgacaaaggctgagtttgttaccttcctgaaggaaactcaaggagagggtgccgatggt
gaggagctgcacgtatttctagacgctgttggctgtaccgaagagcatcctgtacatttg
gacgcattcttatcatttctcagcgacaggcgctttaactccattgtgaacaacagaaag
gtgtctagtgtttaccacgatatgactcgcccgatatgtgagtatttcatcaattcctcg
cacaatacctaccttacgggtgatcaactcttgagcaaatcttccacggatatgtacaag
agggttctactggatggctgccgctgcgttgaacttgattgttgggatggtcgcaagggt
cagcctgtagtttatcatggttacacaaggacttccaagctttggttccgggactgtatt
agcacgatcaagaagtatgctttcgttaattcaatataccctgtcattttgtcgcttgag
gttcacactagcctccgccaacaggatcgaatggcggaaattttgtgtgaaacgctcgga
gatatgctattctgcagtccttggggtgctggtgaacagacttctttcacattctcgccg
gaagcgctaaagggaaaaattctgctaaagagcaaacgggctactacacctaccgatggg
gtacaggttgatgatgacgacgatgaggatgaggaagccgatggtgtggtggaaaatttc
gtaccacctgaaactgctcggcgttgtcgcggtggtggaaaaacgaattcaaggggtgct
gaaaagaaaaagaaggtttcaaaggtttcagagaaactatctcgtcttatttcaatcgaa
tccattggttataagggtgttgaggatctaagttatcttgaaatgcgtcaaccatatcac
tgcagctcttttactgaagggaaagcggggaaaattgcctcttctaaccaggaggagttt
gttgccatcaataatcggtgtttgagtcgcatataccccacaggaactcgcatcggtagc
agtaactttcatcctcaaacgttttggaattgtgggtgccaactagttgcactcaattgg
cagaattacaagtcataccagcttaggctaaatagggggttcttcagcgacaatggtaac
tgcggctaccttctcaaaccgactgctgtggacattgcacgtgcaagggggccaaaacgg
cagtcacggttgctcacaatagaaattatatcagctttctgtcttcccaggcggaaaaat
gcatccggtagcagtattgtggattctcgcgtagccgccttgattgagggccccggcatg
gagaaaagccaacgaaacacatctcccattcacaataatggctttcatcctgtctggcgg
ggtgagcgcctaaacaacgagttctgctggaaggtgtacgagtgggaactgtccaccctt
gtcatgcaggtgtatgacgaggataccaaaagcaataaccttctgggtgaatatgttgtg
ccattacgtgccctaaaaaaaggaattcgccaggtcccccttcgagacctcaaaggatct
attatacatggctcttttttaatggttcaagtatcttatcagtag

DBGET integrated database retrieval system