KEGG   Trypanosoma brucei: Tb11.02.5250Help
Entry
Tb11.02.5250      CDS       T01013                                 

Definition
histone H2B variant
Orthology
K11252  
histone H2B
Organism
tbr  Trypanosoma brucei
Brite
Exosome [BR:tbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tb11.02.5250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 143 aa AA seqDB search
MPPTKGGKRPLPLGGKGKGKRPPGQTTKSSSSRKKSGARRGKKQQRWDLYIHRTLRQVYK
RGTLSKAAVRVLSSFIEDMYGKIQAEAVHVACINNVKTLTAREIQTSARLLLPPELAKHA
MSEGTKAVAKYNASREEAYSKVL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaactaaaggaggaaagcgtccgctcccactcggtggaaagggaaagggcaaa
cgcccacccggtcagacaacaaagtcatcaagcagcaggaagaagagtggcgctcgtcgc
ggaaagaaacaacaacgttgggatttatacatccaccgaactctccgtcaagtttacaag
cgcggcacgctctccaaggctgccgtccgcgtcctatcatccttcattgaagacatgtac
gggaaaattcaggctgaggcggttcatgtggcgtgtattaacaacgtaaagactcttact
gctcgtgaaattcaaacatccgcgaggttgcttcttccaccagaactggcaaagcacgcc
atgagtgagggcacaaaggcagtcgccaaatacaacgcgtcacgcgaggaggcgtactcc
aaggtactgtag

DBGET integrated database retrieval system