KEGG   Trypanosoma brucei: Tb11.02.5420Help
Entry
Tb11.02.5420      CDS       T01013                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Tb11.02.5420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 3665877
NCBI-ProteinID: XP_828830
UniProt: Q384R3
Position
11
AA seq 631 aa AA seqDB search
MIFLVISTAIIAVLAWFVAGVFIRGGGGRGKTAAPQVVGVAQYPSQPSSRVDVRVLFGSQ
TGTAEMFAKTVTREGLRLGVPMKLADVENYRPSDLAGEKYVIIICATYGEGEPTDTMVGF
HEWLVDDSRAVGEELSGVKYTVFALGDRQYKFFCREGITVDRRMSELGAQRFYPLGYGDC
GNSIEEEFDNWCHNLWPVLGRALSLVLKSNSTEPVAPECRMKLWGPPEEAPLPFPKLASV
LEPTQRLPSWAPVKVNKELLSNATGRSTRLIEFDTSETVISYQAGDHLGVLPSNPSEMVN
TYLRVLGVSEQESSQVISLQNRATGKNVFPCRVSIRTALTWYIDLAGPPKKSTLRAFAHH
CTDPVEKDTLLKLLSTEPESVEAYGKLVLELRTVLGFLQRFKSMSPPLSFFLEMMPRIAP
RYFSISSDSLTHPTSVAITVAVVEGGLCTNLLQQAAVGQNIPVFVRKSNFHLPLRAKDRP
IIMIGPGTGVAPFIGFLHRRSAWLEKGNKVGDALLFFGCRRREEDHIYADFMEKCLSNGA
LSVRDVAYSREQADKVYVQHRLAARGKEVWEIISRGGNVYVCGDAKNMARDVERQLLDIA
QKYGAMKEDEATALLEKLATDERYLKDVWTA
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgattttcctcgtgatatccaccgccattatcgcggtccttgcatggttcgttgccggg
gttttcatacgcggtggtgggggtagggggaaaaccgccgcaccacaggttgtaggggtt
gctcaatatccttcacaaccgtcttctcgagtcgacgttcgcgttctcttcggctcgcaa
acaggtactgctgaaatgtttgctaagactgttacgcgagagggcttgagactgggtgtc
cctatgaaacttgctgacgtggaaaattatcgtccgtccgacttggcaggggaaaaatat
gtcattattatctgcgccacgtatggtgagggtgaacccacggacaccatggtcgggttc
catgagtggttggtagacgactcccgtgcagtgggagaggaattaagtggggtgaaatac
acagtgtttgccctcggggaccggcaatacaagttcttttgccgtgaaggcatcacggtg
gaccgccgcatgtctgagttaggtgctcaacgtttctatcccctcggttatggcgactgt
ggaaatagcatcgaagaagaatttgataactggtgtcacaacctctggccagtcttggga
cgcgcactttctctagtactgaaatcgaactcaaccgaacccgtggcacccgaatgccga
atgaaattatggggacctccggaagaggccccgttgccgttccccaagctcgcgtcagtg
ttggaaccaacacaacgattgccttcttgggcaccagtgaaggtgaacaaggagctgctg
agcaatgctaccggaagaagtacaaggttaattgagtttgatacatcagaaactgttatc
tcctaccaggctggtgaccacctcggtgttcttcctagtaaccccagcgaaatggtgaac
acttatctgcgggtgttgggcgtgagcgagcaagaatcaagtcaggtcatctcgctgcag
aacagagcaactggcaagaacgtttttccttgtcgcgtgtcaattcgcactgcactcaca
tggtacatcgatcttgccgggccccccaagaagtctactttgcgtgctttcgcccaccat
tgcactgatcccgttgaaaaggacaccttgttaaaactgctgagtactgaacccgagtcg
gtggaggcgtatggcaagcttgttttggagttaaggactgtccttggctttttgcagcga
ttcaagtcgatgtctcccccgctgagtttcttcttggagatgatgccgcggattgcccca
cggtatttttccatttcgtctgattctctgacccacccgacgagtgtggccattactgtt
gctgtggtcgagggtggcctctgcacgaatttgcttcagcaggcagccgtgggtcaaaac
attcccgtgtttgtgcgaaaatctaacttccaccttccgcttcgagctaaggatcgacca
atcatcatgattggcccgggcacgggtgtagcgccttttattggatttctccaccgccgt
agcgcgtggctggaaaagggtaacaaagttggtgatgcacttttgttttttggttgcagg
aggcgtgaggaggatcatatatatgccgactttatggagaagtgtctatcgaatggggca
ctctccgtgcgggatgttgcttacagcagagaacaagcggataaagtttatgtgcagcac
cgcttagcggcacgcgggaaggaagtatgggaaataatcagcagaggaggaaatgtttac
gtatgcggggatgcaaagaatatggcgagggatgtcgagaggcagctactggacatcgcg
cagaaatatggtgcaatgaaggaggatgaggcgacggcattgcttgagaaactcgcaact
gatgaacggtatttgaaggatgtctggacggcgtga

DBGET integrated database retrieval system