KEGG   Trypanosoma brucei: Tb11.03.0090Help
Entry
Tb11.03.0090      CDS       T01013                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tbr  Trypanosoma brucei
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tb11.03.0090
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tb11.03.0090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 333 aa AA seqDB search
MSAAGVKSGNGCIADTPIVVVGACFVDYVAYVDHLPQVGESLRCRSFSKGFGGKGSNQAV
CAGRLGASVSMVGAVGTDGDGADYIANFQRNGVQVSNVYRMENTSTGLAMIFVDSTTSHN
EIVFSPNATGALTVDYLRKQSDNYNNFFGPKCRYIILQNEIPVETTLDVLKEAHTRGIYT
VFNAAPAPSADEVAVVKPFLSYVSLFCVNEVEASMITGIDVKDTQSAILATEEMQKLGAH
SVVTTLGGNGYVIGEKGKPPRHLPSITVKAVDSTGAGDCFVGAMVFYLSMGKSLEESCKR
ANMIAAISVQRPGTQSSYPTLDELPAEVKECKI
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgccggcgttaagagcgggaacggatgcatcgcagacactcctattgtcgtg
gttggcgcttgctttgtggactacgtcgcctacgttgatcaccttccacaggttggggaa
tcgctcaggtgtcgcagtttcagcaaaggttttggtggtaaaggctctaaccaggccgtc
tgcgctggacgtctgggagcatccgtttcaatggtgggcgctgtgggaactgatggcgat
ggtgcggattacatcgcgaacttccaaaggaatggcgtccaggtgtcgaatgtttaccga
atggaaaacacctcaacggggctcgcgatgatctttgttgattccactacgtcccacaat
gaaatagtgttttcgcccaacgccaccggtgcccttacagtggattatctccgtaagcag
tccgataactacaacaattttttcggccccaagtgtcgctacatcattttacagaacgaa
attccagttgaaacaacgcttgacgtgcttaaggaggcccatacacgcggtatttacact
gtcttcaacgctgcccccgctccttcggcggacgaggtggctgttgttaagccttttctt
tcatatgtgtcactgttttgcgtgaatgaggtggaggcatcgatgatcactggtattgac
gtgaaagacacccagtccgccatccttgctacggaggaaatgcagaagttgggtgcacac
agtgttgtaacgactctcggaggaaacggctacgttattggcgagaagggcaaaccacca
cgacacttgcccagtatcactgtgaaggctgtggattccactggtgctggcgactgcttc
gttggtgccatggtgttttatctgtcgatgggcaaatccctcgaggagtcctgcaagagg
gcgaatatgattgcggcaatcagtgttcagcggccaggcacccaatcgtcctatcccaca
cttgacgagctgcctgctgaggtgaaggaatgcaaaatatag

DBGET integrated database retrieval system