KEGG   Trypanosoma brucei: Tb11.03.0890Help
Entry
Tb11.03.0890      CDS       T01013                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
tbr  Trypanosoma brucei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 236 aa AA seqDB search
MTKTWLPLESNPDVLNEYLKSLGLTNPKVAFNDVFGLDAELLAMVPRPIYAMILLYPLSD
GMESGDAAACLKQKSEIEQFMTTNKFFYSKQTISNACGTMAVLHAVLNNTDVVGDMLEGS
PIATLLWSTKDKSPEENAKLIESDSLLDQAHALASASGVTDNQPLDADIDLHFTCFVKIG
DRCVELDGRKPHPLLHGHCVDEESFVKSCVDAIKEKMGRDPQSPRFNIIALCESRE
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaacgtggctaccgctcgaaagcaatcccgatgtgttgaacgaatatctgaag
agtttagggttgaccaacccaaaggtggcattcaacgatgtgtttggcctggatgccgaa
ttactcgccatggtcccccgaccgatttacgcgatgattcttttgtatccattgtcagat
gggatggagtctggagatgctgcagcttgtctcaagcaaaaatctgaaatagagcagttt
atgacgacaaacaagttcttctacagcaaacagacaatttccaatgcttgcggcaccatg
gctgtgctccacgctgttctcaataacacggatgttgtgggcgacatgttggagggaagc
ccaattgctacacttctgtggagtacgaaggataaatcccccgaggaaaatgcaaaacta
attgaatcagattccctgcttgaccaggcacatgcattggcgtcagcatcaggtgttacc
gataatcagcctctcgacgcagatatcgaccttcattttacctgttttgtaaagataggt
gatcgctgtgtggaacttgacggaagaaagcctcatccacttcttcatggccattgcgtg
gacgaggagagttttgtaaagtcatgcgtggatgcgattaaggagaaaatgggtcgggac
ccacaatctcctcggttcaatattattgcactgtgtgagtctcgcgagtga

DBGET integrated database retrieval system