KEGG   Trypanosoma brucei: Tb11.18.0004Help
Entry
Tb11.18.0004      CDS       T01013                                 

Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
tbr  Trypanosoma brucei
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Tb11.18.0004
Translation factors [BR:tbr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Tb11.18.0004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 233 aa AA seqDB search
MMAESSAKEMEANQVSAAGDQTAKADDRYVIIDRGVKRHLLNRPWTLWYDSVSTYDCKQW
ELSLIEVMTVRTVEDFFAMLHYCKPPHVLRVSAQYHFFREGVKPMWEDPNNKAGGKLWVS
LDDKTMTDKSGAAGGGKTRKDNGADADKKPELDTVWENVLIALVGEYLDYGVEGEHIMGV
VLTKRKYCNRIALWLKDASDSDAVAAIEKQLVKEAGLLPATKPIFTAHGASKA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgaatcaagcgcgaaagagatggaagcgaatcaggtttccgcggctggcgat
caaaccgctaaggctgatgatcgatatgttattattgacaggggcgttaagcgacatttg
ctcaatcgcccgtggacactttggtatgattcggtttctacgtatgattgcaaacaatgg
gagctttctcttatcgaggtgatgacggtacgcacggtggaggatttcttcgcgatgctt
cactactgtaaacctccccatgtcctccgtgtttcagcacagtaccattttttccgtgag
ggcgttaagccaatgtgggaggatcccaacaacaaagctggtgggaagttgtgggtgagc
ctcgatgataaaaccatgacggacaagagtggagctgcaggtggcggaaagacgagaaag
gataatggtgccgatgcggataagaaaccagaactggacaccgtttgggaaaatgtgctc
atagctctggtaggtgagtatcttgattatggtgtggagggagaacacattatgggtgtc
gtgttgacaaagcggaaatactgcaatcgcattgcgctgtggctaaaagacgcatcggac
tccgacgccgttgctgccattgaaaagcagttggtgaaggaggcgggtttattacccgca
acgaaacccatcttcacagcccatggcgctagcaaggcctaa

DBGET integrated database retrieval system