KEGG   Trypanosoma brucei: Tb927.1.3950Help
Entry
Tb927.1.3950      CDS       T01013                                 

Definition
alanine aminotransferase (EC:2.6.1.2)
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
tbr  Trypanosoma brucei
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tb927.1.3950
   01210 2-Oxocarboxylic acid metabolism
    Tb927.1.3950
   01230 Biosynthesis of amino acids
    Tb927.1.3950
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tb927.1.3950
Enzymes [BR:tbr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Tb927.1.3950
Amino acid related enzymes [BR:tbr01007]
 Aminotransferase (transaminase)
  Class I
   Tb927.1.3950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 569 aa AA seqDB search
MDIYLFSVWFIQNEEKCLDFLNISKKNKAKSSVQHIGGLARKQNPEPTKSIFVSRYGARS
LKTSTMKGNQEFFQKGGAHVSKGVHINPRVKKAQYAVRGLVPMRADEIREEIRSGTGKSK
FSFNELVYCNIGNPQALEQKPLTFHRQVMSLIDAPFLLEDNAVVSRYPSDAVSRARLYLG
HIGQRTGAYTDSAGYAFVRDIVAQYVNERDAYVKPLQEASSIVLTDGASTGVRIILQTLV
GDEKDAVMIPIPQYPLYTAQIALLGGTPAMYYLRESEGWALNVGELEAVYKDCVANGNAT
PRVLVVINPGNPTGGVLERTVMEEVAKFCCDHGVVLMADEVYQENIYTATKRFESFRKIV
LELPPPYNTDTVLVSLHSVSKGIIGECGRRGGYFTLTNAPPELVEQVMKLCSINLCSNVN
GQLMTALMCSPPKPGDASFDHYTAEYSGIFESLKRRADLLAKELNNIRGFKSQSVEGAMY
AFPTIELPPKYVKHNDEMNSKEGRQLAPDARWALELLESTGIVVVPGSGFGQQPGTLHFR
TTILPPEAHMERVVKALRQFQEGIWAKYA
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggatatatatttattttccgtttggtttatacagaacgaggaaaagtgtttggatttt
ctaaacattagtaagaagaacaaagccaagtcgagcgtacaacacattggcgggttagcg
cgaaaacagaatcctgaacccacaaaatcaatttttgtgtcgagatacggagcacgatca
ctgaagacctcgacaatgaaaggtaaccaggaattttttcagaagggtggggcccacgtt
tccaagggcgttcacatcaacccacgcgtaaagaaggctcagtatgccgtgcgcgggctt
gtgccgatgcgagccgacgaaatcagggaggaaatccgttcaggcacggggaagtcgaag
ttctccttcaacgaactggtttactgcaacattggcaacccccaagccctggagcagaag
ccgcttacctttcaccgccaagtgatgtcgcttatcgatgctccatttctgcttgaggat
aacgccgtcgtctctcgatatccctctgatgctgtttcccgtgcgcgtctctacttgggc
cacatcggccaacgtactggcgcctacacggactccgcaggctatgcctttgtacgtgac
atcgtcgcgcagtatgtgaatgagcgtgacgcctatgtaaaaccgcttcaggaggcatcg
tcgattgtgcttacagacggcgcaagcactggtgtgcgcataatcttacagacgcttgtg
ggcgatgagaaggacgctgtgatgattcccatcccgcagtatccgctgtacacggcacag
attgcattgttgggaggtacccccgcgatgtattaccttcgtgagagcgaaggctgggcg
ctgaacgttggagagctcgaggcagtatacaaagactgtgtggcgaacggaaacgcgacg
ccccgcgtgctcgtcgtgattaaccctggtaaccctacaggtggcgtgttggagcgcact
gtgatggaggaggttgccaagttctgttgcgatcacggtgttgtgctcatggccgatgag
gtttaccaggaaaatatctacaccgcgaccaagcggtttgagagttttcggaagattgtg
ctcgaacttccaccaccatacaacaccgacaccgtgcttgtttccttgcactccgtgtcg
aagggtattatcggtgagtgtggtcgccgtggtgggtacttcacactcacaaacgctccg
cctgagttagtggagcaggtgatgaaattgtgctctattaacctctgcagcaacgtcaac
ggtcagcttatgacggcactgatgtgctccccgccgaaacctggcgatgcgagcttcgac
cactacacggcagagtacagtggcatttttgaaagccttaagcgccgtgctgacctgctt
gcaaaggaactgaacaacatccgtggtttcaagtcccaatctgttgagggcgccatgtac
gctttccccactattgagctccctcccaagtacgtgaagcacaacgatgagatgaactca
aaggagggccgacagcttgcgccggacgcgcgttgggcactggagcttctcgagagcacc
ggtattgttgtggtgccgggttctggctttgggcagcagcctgggacactgcacttccgc
acgacgatcctcccacccgaagcgcatatggagcgtgtggtgaaggctctgcgccagttc
caggagggcatttgggccaagtatgcataa

DBGET integrated database retrieval system