KEGG   Trypanosoma brucei: Tb927.3.2220Help
Entry
Tb927.3.2220      CDS       T01013                                 

Gene name
Tb03.48O8.730
Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
tbr  Trypanosoma brucei
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Tb927.3.2220 (Tb03.48O8.730)
Translation factors [BR:tbr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Tb927.3.2220 (Tb03.48O8.730)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 220 aa AA seqDB search
MEEDYHEYDDAADDWEVEAQQGEAAEEEALKRKLREQQALLEKERQRRRARASARTEEEE
LLPADVARALEDMKSTASSAGEALNVVKDSENAVKLIADMPVNTAAEAEALGVVLADRLL
SFSESPHFNSILSVVFRDIAREFKSGNALDTLRTIKDKVSNASKVCEGKMKQTKGDKREQ
PGKEGASAKGGSSAGDALGLDTIGDEGGAANVPDGDDNFM
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggactaccatgagtatgacgacgctgctgatgactgggaggttgaagcccag
caaggagaagctgccgaggaggaagcccttaagcgaaaactgcgagaacaacaagcccta
ctggagaaggaaaggcagcgaagacgtgccagagcttctgcacgaactgaagaggaggag
ctattacccgctgacgttgcaagggctcttgaagatatgaaaagcacggcaagcagtgcc
ggggaagccctgaatgtggtaaaagacagtgagaacgccgtaaagctcatcgctgacatg
cccgtcaacactgccgcggaggcggaggcgctcggtgtcgtattggctgaccgccttctt
agcttttctgagtctccacacttcaactcaatcctttctgtcgttttccgtgatatagcc
cgtgagtttaagtcaggcaacgcccttgacaccctcaggaccattaaggacaaggtatca
aacgcaagtaaggtttgtgaaggaaaaatgaagcaaacaaagggtgacaagcgggagcaa
ccggggaaggaaggggcatccgcaaagggtggctcttcagcaggagatgcactgggattg
gacaccataggggatgagggtggtgctgccaacgttcccgatggtgatgacaactttatg
tga

DBGET integrated database retrieval system