KEGG   Trypanosoma brucei: Tb927.3.3270Help
Entry
Tb927.3.3270      CDS       T01013                                 

Gene name
Tb03.3K10.320
Definition
ATP-dependent phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tbr  Trypanosoma brucei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tb927.3.3270 (Tb03.3K10.320)
   01230 Biosynthesis of amino acids
    Tb927.3.3270 (Tb03.3K10.320)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tb927.3.3270 (Tb03.3K10.320)
   00030 Pentose phosphate pathway
    Tb927.3.3270 (Tb03.3K10.320)
   00051 Fructose and mannose metabolism
    Tb927.3.3270 (Tb03.3K10.320)
   00052 Galactose metabolism
    Tb927.3.3270 (Tb03.3K10.320)
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tb927.3.3270 (Tb03.3K10.320)
Protein phosphatases and associated proteins [BR:tbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tb927.3.3270 (Tb03.3K10.320)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3
AA seq 487 aa AA seqDB search
MAVESRSRVTSKLVKAHRAMLNSVTQEDLKVDRLPGADYPNPSKKYSSRTEFRDKTDYIM
YNPRPRDEPSSENPVSVSPLLCELAAARSRIHFNPTETTIGIVTCGGICPGLNDVIRSIT
LTGINVYNVKRVIGFRFGYWGLSKKGSQTAIELHRGRVTNIHHYGGTILGSSRGPQDPKE
MVDTLERLGVNILFTVGGDGTQRGALVISQEAKRRGVDISVFGVPKTIDNDLSFSHRTFG
FQTAVEKAVQAIRAAYAEAVSANYGVGVVKLMGRDSGFIAAQAAVASAQANICLVPENPI
SEQEVMSLLERRFCHSRSCVIIVAEGFGQDWGRGSGGYDASGNKKLIDIGVILTEKVKAF
LKANKSRYPDSTVKYIDPSYMIRACPPSANDALFCATLATLAVHEAMAGATGCIIAMRHN
NYILVPIKVATSVRRVLDLRGQLWRQVREITVDLGSDVRLARKLEIRRELEAINRNRDRL
HEELAKL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgaatctcgcagccgcgttacgagcaagctcgtcaaggcccaccgcgccatg
ctgaacagcgtgactcaggaggacctcaaggtggaccgcctccccggtgcggattacccg
aacccgtccaaaaaatattcgtcgcgcacagagttccgtgacaagacggattacatcatg
tacaacccccgccccagggatgaaccctcttcggagaaccctgtatcggtgagcccactc
ctttgcgaacttgctgctgcccgctcgcgcattcacttcaacccgacggagaccaccatt
ggtattgtcacgtgcggtggtatttgccccggcctcaacgacgtcatccgttccatcacc
cttaccggcatcaacgtgtacaacgtaaagcgcgtgattggcttccgcttcggatactgg
ggcctttccaagaagggcagtcagacggccattgaactccaccgcggaagagtcaccaac
atccaccactatggcggcaccatcctaggcagcagccgtggtccgcaggaccccaaggag
atggttgatactctcgagcgcctcggtgtcaacatcctcttcaccgtcggtggtgacggc
acgcagcgcggtgcgctcgtcatctctcaagaagccaagcgccggggtgttgacatctcc
gtttttggtgttcccaagactattgacaacgacctcagcttctctcaccgcacgttcggc
ttccagactgctgttgagaaggctgtgcaggccatccgcgcggcgtatgctgaggctgtc
tccgccaactatggtgttggcgttgtgaagctcatgggtcgtgacagcggcttcattgcc
gctcaggctgcagtggccagtgcgcaggcgaatatctgccttgttcctgaaaaccccatc
tccgagcaggaggtgatgtcccttctggagcgccgattctgccattcccgttcctgcgtc
atcatcgtcgctgagggattcgggcaagactggggccgcggctctggtggttatgacgcg
tctggcaacaagaagctgattgacatcggcgttatcctcacggagaaagtgaaggctttc
ctcaaggcaaacaagtctcgctaccctgactcgacagttaaatacattgacccctcgtac
atgattcgtgcttgcccaccgtcggccaatgacgccctcttctgcgccacccttgccact
cttgcggtacatgaggcaatggctggtgccacgggctgcattattgccatgcggcacaac
aactatattcttgtgcccatcaaggtggccacttccgtccgccgtgtgctcgacctccgc
ggacagctgtggcgtcaggtgcgtgaaatcacagtggatctgggcagcgacgtccgcctg
gctcgtaaattggagatccgccgtgaactggaggcaatcaacaggaatcgcgaccgcctc
cacgaggaactggccaagctctaa

DBGET integrated database retrieval system