KEGG   Trypanosoma brucei: Tb927.3.3270Help
Entry
Tb927.3.3270      CDS       T01013                                 

Gene name
Tb03.3K10.320
Definition
ATP-dependent phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tbr  Trypanosoma brucei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tb927.3.3270 (Tb03.3K10.320)
   01230 Biosynthesis of amino acids
    Tb927.3.3270 (Tb03.3K10.320)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tb927.3.3270 (Tb03.3K10.320)
   00030 Pentose phosphate pathway
    Tb927.3.3270 (Tb03.3K10.320)
   00051 Fructose and mannose metabolism
    Tb927.3.3270 (Tb03.3K10.320)
   00052 Galactose metabolism
    Tb927.3.3270 (Tb03.3K10.320)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Tb927.3.3270 (Tb03.3K10.320)
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tb927.3.3270 (Tb03.3K10.320)
Protein phosphatases and associated proteins [BR:tbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tb927.3.3270 (Tb03.3K10.320)
Messenger RNA biogenesis [BR:tbr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Tb927.3.3270 (Tb03.3K10.320)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3
AA seq 487 aa AA seqDB search
MAVESRSRVTSKLVKAHRAMLNSVTQEDLKVDRLPGADYPNPSKKYSSRTEFRDKTDYIM
YNPRPRDEPSSENPVSVSPLLCELAAARSRIHFNPTETTIGIVTCGGICPGLNDVIRSIT
LTGINVYNVKRVIGFRFGYWGLSKKGSQTAIELHRGRVTNIHHYGGTILGSSRGPQDPKE
MVDTLERLGVNILFTVGGDGTQRGALVISQEAKRRGVDISVFGVPKTIDNDLSFSHRTFG
FQTAVEKAVQAIRAAYAEAVSANYGVGVVKLMGRDSGFIAAQAAVASAQANICLVPENPI
SEQEVMSLLERRFCHSRSCVIIVAEGFGQDWGRGSGGYDASGNKKLIDIGVILTEKVKAF
LKANKSRYPDSTVKYIDPSYMIRACPPSANDALFCATLATLAVHEAMAGATGCIIAMRHN
NYILVPIKVATSVRRVLDLRGQLWRQVREITVDLGSDVRLARKLEIRRELEAINRNRDRL
HEELAKL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgaatctcgcagccgcgttacgagcaagctcgtcaaggcccaccgcgccatg
ctgaacagcgtgactcaggaggacctcaaggtggaccgcctccccggtgcggattacccg
aacccgtccaaaaaatattcgtcgcgcacagagttccgtgacaagacggattacatcatg
tacaacccccgccccagggatgaaccctcttcggagaaccctgtatcggtgagcccactc
ctttgcgaacttgctgctgcccgctcgcgcattcacttcaacccgacggagaccaccatt
ggtattgtcacgtgcggtggtatttgccccggcctcaacgacgtcatccgttccatcacc
cttaccggcatcaacgtgtacaacgtaaagcgcgtgattggcttccgcttcggatactgg
ggcctttccaagaagggcagtcagacggccattgaactccaccgcggaagagtcaccaac
atccaccactatggcggcaccatcctaggcagcagccgtggtccgcaggaccccaaggag
atggttgatactctcgagcgcctcggtgtcaacatcctcttcaccgtcggtggtgacggc
acgcagcgcggtgcgctcgtcatctctcaagaagccaagcgccggggtgttgacatctcc
gtttttggtgttcccaagactattgacaacgacctcagcttctctcaccgcacgttcggc
ttccagactgctgttgagaaggctgtgcaggccatccgcgcggcgtatgctgaggctgtc
tccgccaactatggtgttggcgttgtgaagctcatgggtcgtgacagcggcttcattgcc
gctcaggctgcagtggccagtgcgcaggcgaatatctgccttgttcctgaaaaccccatc
tccgagcaggaggtgatgtcccttctggagcgccgattctgccattcccgttcctgcgtc
atcatcgtcgctgagggattcgggcaagactggggccgcggctctggtggttatgacgcg
tctggcaacaagaagctgattgacatcggcgttatcctcacggagaaagtgaaggctttc
ctcaaggcaaacaagtctcgctaccctgactcgacagttaaatacattgacccctcgtac
atgattcgtgcttgcccaccgtcggccaatgacgccctcttctgcgccacccttgccact
cttgcggtacatgaggcaatggctggtgccacgggctgcattattgccatgcggcacaac
aactatattcttgtgcccatcaaggtggccacttccgtccgccgtgtgctcgacctccgc
ggacagctgtggcgtcaggtgcgtgaaatcacagtggatctgggcagcgacgtccgcctg
gctcgtaaattggagatccgccgtgaactggaggcaatcaacaggaatcgcgaccgcctc
cacgaggaactggccaagctctaa

DBGET integrated database retrieval system