KEGG   Trypanosoma brucei: Tb927.3.4840Help
Entry
Tb927.3.4840      CDS       T01013                                 

Gene name
Tb03.48K5.520
Definition
ubiquitin hydrolase (EC:3.1.2.15)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Tb927.3.4840 (Tb03.48K5.520)
Peptidases [BR:tbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Tb927.3.4840 (Tb03.48K5.520)
Exosome [BR:tbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tb927.3.4840 (Tb03.48K5.520)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 731 aa AA seqDB search
MPPPFSITQEACAHCWDESAVTTPHHQSAVHKEECAYCCRTCMHNGGVLVCMCCHIALCE
VHVRKHVSLRSNHAMYVWLKECPQKEDDAPRDVNKLGVVLPKEYESAICCALCSLTFSSP
PELLEGCYQSILNATSTGAQGAIDANEEQFTRPQCPHLVCLEQQPSPFSPAPSHMETCVV
AGCGCQTDNWMCVTCGAVGCPRPEVGGRGHALEHHNTTQHPVVVKLGTITPSGADFYCYS
CDDEVSDVHFEAHMKHFGIDVKTSKKTAKTFGEIQYDYWSQFDFNRITESGETLVPVFGP
GRTGMRNFGNTCYMNCVLQCLMSLEVFKEAFYAGRDTRHQNACRENPYKCRSCQVERVAS
GLLSGEFSISDNDEPNGITAREFKQVFAEGHPEFSTSEQQDAQEYFLYLLEEMRRYVKPS
CVDAKQNRHPVDIFKMKLENRVECSSCRKVRYTYESDCCLSLPIPLGTAERRSACNRKLT
EEEIEASRPRTSLEACITSLMKTIEVDCSCSACGNQVTYNETVRVATFPDVLAVYLRRAH
FDAETMTVTKRDVFVEVPEEVDLEYLRGKGLQSGEVEMPSNERELRHKPVSAALTPVDEM
ALATLLSMGVDEKIAKYALQQTGMNVERALDYVFSRNDIEGEIARAEGSEGQLVSRGNVT
APEVDGPASYRLHAMISHMGASAKTGHYVCHIRDEETGKWLLFNDEKVAESKQPPFALAS
LYFYKRKRVSN
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctcccttttctataactcaggaggcatgtgcccattgctgggatgaatcggct
gttacaactccgcatcatcagtccgccgttcacaaggaggagtgcgcttactgctgccgg
acatgcatgcacaatggaggtgttttggtgtgcatgtgttgccatatcgccctctgtgaa
gtgcacgtgaggaagcacgtttcactgcgctcgaaccatgcgatgtacgtatggctgaag
gagtgtccccagaaggaggatgatgcaccgagggatgtgaacaaacttggcgttgtactc
ccaaaagaatatgagagcgccatctgctgcgccctgtgctcactcacgttctcgtcgccc
cccgagttgcttgagggatgctaccagagtatcttgaatgccacctccacaggagcgcag
ggagccatagacgcaaatgaagagcagtttactcggcctcagtgtccacatttggtatgt
ctcgagcagcaacctagcccattctcaccggcgccgagccacatggagacttgtgttgtt
gcgggttgtggttgtcagacggataattggatgtgcgtgacatgtggggcagttggttgc
ccgcgacctgaagtaggtggcaggggccatgcactggaacaccacaacaccacgcagcat
cctgttgtggtcaaacttggcacgataactccgtcaggcgcagacttctactgttattct
tgcgatgatgaagtatccgatgtgcactttgaggcccatatgaagcacttcggcatagat
gtgaaaacatcaaaaaaaactgcaaaaactttcggagagatacagtacgattattggtcg
caatttgacttcaaccggattacggaaagtggggaaactcttgttccagttttcggccct
ggaagaaccgggatgcgaaacttcggcaacacgtgctacatgaactgcgttttacagtgt
ctaatgtcgctagaggtctttaaagaggcgttctacgccggccgcgacacacggcaccag
aatgcctgtagagaaaacccctacaagtgtcgtagttgccaggtggagcgcgttgccagc
ggcctgctttccggtgaattttccataagtgacaatgatgagcccaacggtataacggca
cgtgagtttaagcaagttttcgcggaggggcatcccgaattcagcaccagtgagcagcag
gacgcccaggagtactttttatatctattggaggaaatgcgccgctacgtcaaaccctca
tgtgtcgacgcgaagcaaaaccggcacccggttgatatttttaagatgaagttggagaat
cgtgttgagtgtagctcttgccgcaaggtacgttacacgtatgagtcagactgttgtctt
tcgctccccatccccctgggtaccgcagagcggaggtctgcttgtaaccgcaaactcacg
gaagaagaaattgaggcaagtcgtcctcggacctcgctggaagcctgtataacatctttg
atgaaaaccattgaagtagactgcagctgtagtgcgtgcgggaaccaggtcacctacaac
gaaactgtacgcgtggcgacgtttccggatgttctcgcagtttacctccgtcgggcacac
ttcgacgcggagacaatgacagtgacgaagcgggatgtgtttgtagaggtaccggaggaa
gttgacttggagtatcttcgtggaaagggactacagagcggtgaagtggagatgccttcc
aatgagcgggaactgcgacacaagccggtttccgcagcgctcacgccggtggacgagatg
gcgctcgctacactgcttagcatgggtgttgatgaaaaaattgcaaaatacgcgctgcag
cagacaggcatgaacgtggagagggcacttgattacgtgttcagccgcaacgacattgag
ggggaaatcgcaagggccgagggctctgaaggtcaattggtttcccgcgggaatgtcact
gcacccgaggttgatggaccggcaagctaccgattgcacgccatgataagtcacatggga
gccagtgccaagacgggacactatgtatgccatatacgggatgaagaaacagggaaatgg
ttgttgtttaatgacgaaaaggtggcggagtcaaagcagccaccctttgccttggcatct
ctttacttttacaagagaaaaagggtttctaattag

DBGET integrated database retrieval system